KEGG   Halophilic archaeon: Halar_2641Help
Entry
Halar_2641        CDS       T01603                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hah  Halophilic archaeon
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Halar_2641
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Halar_2641
Enzymes [BR:hah01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Halar_2641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1858237..1859172)
Genome map
AA seq 311 aa AA seqDB search
MTRNRTSATDRQPVRIIGAPTDYGQDRRGVDMGPSAIRYAGLADSLGNAGVETDDVGDLL
APRAEERDPEHRTPSKGEARFLRETQDVCVRLSKEVRAALVDDHTPLVLGGDHSVAIGSL
VGSAADADIGAVWFDAHGDYNTPSTSPSGNIHGMPLAAALGVKEWADTDWANAAGLSEEN
IAIVGLRSIDDTERELLAESDITTYTMSDIDQRGLAEVVRSALAVASDGVDGYHVSLDLD
WLDPTIAPGVGTPVRGGVTYREAHHAMEILAQQGGMRSMELVEVNPILDESNETARMAVE
LAASAFGKQIL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacacgaaaccggacatcggcaaccgatagacagccggtacgaattatcggcgccccg
actgactacggccaggaccggcgtggggtggacatgggcccgtccgccattcgctacgcc
ggcctcgccgatagcctcgggaacgctggcgtggaaacggacgacgtcggtgacctgctc
gcaccacgggctgaagagcgcgaccccgaacaccggaccccgagcaagggggaggcaagg
tttctccgggaaacccaggacgtctgtgttcgactctcgaaggaggtccgtgcggccctc
gtcgacgaccacacgccgctcgtgctcggcggggaccactccgtcgccatcggttcgctc
gtgggatcggctgcagacgccgatattggcgcggtctggttcgacgcccacggcgactac
aacacaccctcgaccagcccctcgggcaacatccacgggatgccgctggcggccgcactc
ggcgtgaaagagtgggccgacaccgactgggccaacgccgcgggactcagtgaggagaac
atcgccatcgtcggcctgcggtcgatcgacgacacggaacgcgaacttctcgccgagagc
gatatcaccacctacacgatgtcggatatcgaccagcgcggactcgccgaagtggtccgg
tcggcactcgccgtcgcctccgacggcgtcgacggctaccacgtgagtctcgacctcgac
tggctcgacccgacaattgcccccggcgtcgggacgccggtccgaggtggcgtcacctac
cgagaggcccaccacgcgatggagatcctcgcccaacagggcgggatgcgctcgatggaa
ctggtggaagtcaacccgattctcgacgagagtaacgagaccgcgcggatggcggtcgaa
ctcgccgccagtgcgttcggcaagcagattctctga

DBGET integrated database retrieval system