KEGG   Halophilic archaeon: Halar_2747Help
Entry
Halar_2747        CDS       T01603                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hah  Halophilic archaeon
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Halar_2747
Enzymes [BR:hah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Halar_2747
Exosome [BR:hah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Halar_2747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1964946..1966481
Genome map
AA seq 511 aa AA seqDB search
MAPTYIGAIDQGTTGTRFMVFDRGGRVVASAYERHEQLYPNPGWVEHDPLEIWEHVQQVV
VDALADAGLDASQLAALGITNQRETTVVWDAASGRPVHNALVWQDRRTTDRVEELEAAGR
VDEIRATTGLECDAYFSATKTEWLLDNAEPVTLQSSRGRDLRERARDRELLMGTIDSWLI
HKLTGNHITDVTNASRTMLYDIHEMAWDEDLLAEFGVPREMLPEVRPSSDEELYGHTDPD
GFLGAAVPVAGALGDQQAALFGQTCFDAGDAKNTYGTGSFYLLNTGTDAVDSDHGLLTTV
AFQQSGEPARYALEGSIFVTGAAIEWLEDVDLINNAAQTAELARSVDSTDCVYMVPAFTG
LGAPHWDGRARGTIVGMTRGTRKEHIVRATLESIAYQTRDIAEAMAADSGVETTALRVDG
GAVENDFLCQLQADILQTAIVRPEVTETTALGAAYAAGLAVDYWESLGALRANWRVDREF
SPEMAPDEADAKYDRWGDAVDRSLDWARDED
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggcacccacctacatcggcgcgatcgaccaaggaacgacgggcacgcggttcatggtg
ttcgaccgcggcgggcgcgtcgttgccagcgcctacgaacgacacgaacagctctacccc
aatccggggtgggtcgaacacgaccccctcgaaatctgggagcacgtccagcaggtcgtc
gtcgacgcgctcgctgacgcggggctggatgcctcgcagttggcggcgctcggcatcacc
aaccagcgcgagacgaccgtcgtctgggacgcagcgagcgggcggcccgtccacaacgca
ctggtctggcaagaccgccggactaccgaccgggtggaggaactcgaggccgccggccgc
gtcgacgaaattcgggccacgaccggtctcgagtgtgacgcctacttctcggcgaccaaa
accgagtggctcctggacaacgccgaaccagtgacgctccagagcagccgggggcgggac
cttcgcgagcgggcccgcgaccgcgaactcctgatgggcaccatcgattcgtggctcatc
cacaagctcacgggcaaccacatcaccgacgtgacgaacgcctcgcggacgatgctctac
gacatccacgagatggcgtgggacgaggacctgctcgcggagttcggcgtgccccgcgag
atgctgcctgaggtccggccctcctccgacgaggaactctacggccacaccgaccccgac
ggcttccttggcgccgcggtacccgtcgccggcgcactcggcgaccagcaagcggcgctg
ttcggccagacgtgcttcgacgccggcgacgcaaagaacacctacggcaccggctcgttc
tacctgctgaacaccggcaccgacgccgtcgactcggaccacggcctcctcacgacggtg
gcgttccagcagtcgggcgaacccgcccggtacgcgctggagggatcgattttcgtcacc
ggtgcggccatcgagtggctggaggacgtcgacctcatcaacaacgctgcccagaccgct
gaactcgctcggtcggtcgattcaacagattgcgtctacatggtgccagcgttcacgggc
ctcggcgcgcctcactgggacggccgcgccagggggaccatcgtcggaatgactcggggc
acccggaaggagcatatcgtccgggcgaccctggagtcaatcgcctaccagacccgagat
atcgccgaggcgatggctgcggactccggtgtcgagaccacggccttgcgcgttgacggt
ggcgcggtggagaacgacttcctctgtcagctacaggccgacatcctgcagaccgccatc
gtccgcccggaggtgaccgagacgactgcgctgggcgcggcctacgcggctggcctcgcg
gttgactactgggagagcctcggcgcgcttcgggcgaactggcgagtcgaccgcgagttc
agcccggagatggctcccgacgaggccgacgcgaaatacgaccgctggggcgacgcagtc
gaccggtccctcgactgggctcgagacgaggactga

DBGET integrated database retrieval system