KEGG   Halophilic archaeon: Halar_2851Help
Entry
Halar_2851        CDS       T01603                                 

Definition
dihydrolipoyllysine-residue acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hah  Halophilic archaeon
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halar_2851
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halar_2851
   00020 Citrate cycle (TCA cycle)
    Halar_2851
   00620 Pyruvate metabolism
    Halar_2851
Enzymes [BR:hah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Halar_2851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2063832..2065328
Genome map
AA seq 498 aa AA seqDB search
MAIKEFKLPDVGEGVAEGELVSWAVSVGDAVSEGDIVAEVETDKALVEVPSRYDGKIAEL
HAEEGEIVPVGSVIISFDVDDGAAGGEDAPTAEADDTVEESADTDSDEAAAASTADGRVF
APPSARKLARELGVEIGAVEGTGPGGRVSDADVRAHADAEETEESGEEAAPDAATTEPVG
GTADAETTSTTTAAASGAGADREKTLAVPATRRVAKELDVDIDAVPTAETREGEAFVTEQ
HVREFAEGGAEAGEPATAAAGSATGDQPREETVPYRGIRRTIGDQMAKSKFTAPHVTHHD
TAEIDELVAAREELKATAEEKGSRLTYMAFVLKAVTAALKEYPVLNSELDEEEGVIRLKN
YYNIGIAVATDAGLMVPVVKHVDQKGLLQLADEIQELATKARDRSITRTEMQDGTFTITN
FGAFGGEYATPIINHPETAIMGLGAIKQRPVVQDGEVEAAHTLPLSLAIDHRVIDGAEAA
QFTNAVKSYLAEPTKLLL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggctatcaaagagttcaaactacccgacgttggcgaaggcgtcgccgaaggcgaactg
gtctcgtgggcggtgtcggtcggcgatgccgtctccgagggtgacatcgtcgccgaagtc
gagactgacaaggcactggtcgaggtgccctcccgctacgacgggaaaattgccgaactg
cacgccgaagaaggcgaaatcgtccccgtcggctccgtcatcatctccttcgatgtcgat
gatggtgcggctggtggcgaggacgcccccaccgccgaggccgacgacactgtcgaggaa
agcgcagacaccgattccgacgaggccgcagcagcgtcgaccgcagatggtcgtgtgttc
gcgccgccgtccgcccggaagctggcccgcgaactcggcgtcgagataggcgccgtcgag
ggcaccggccccggcggtcgcgtgagtgacgctgacgtgcgcgcccacgccgacgcagag
gagaccgaagagagcggcgaggaagctgctcccgacgcggcgacgaccgaaccggtcggc
ggaacggccgacgccgagacgacctcgacgacgaccgcagccgcctccggcgcgggcgcc
gaccgcgagaagaccctcgcagtgccggcgacccgccgcgtggcgaaggaactcgacgtc
gacatcgacgcggtcccgacagcggaaacccgcgagggcgaggcgttcgtcaccgaacag
cacgtccgagagttcgcagagggcggcgccgaggccggcgagccggcgactgcggccgcc
gggtccgcgaccggcgaccaaccccgtgaggagacggtcccctaccgcggaatccgccgg
accatcggcgaccagatggcgaaatcgaagttcaccgcaccgcacgtcacccaccacgac
acggccgaaatcgacgaactggtggcggcacgtgaggaactcaaggcgaccgcagaggag
aaaggcagccgcctgacctacatggcgttcgtgctgaaggccgtgacggcggcgctcaag
gagtaccccgtcctcaactccgaactcgacgaggaggagggtgtcatccggctgaagaac
tactacaacatcggcatcgccgtcgcgactgacgcggggctgatggtgccggtcgtgaag
cacgtcgaccagaaggggctgctccagttggccgacgagatacaggagttggcgacgaag
gctcgcgaccgctccatcacccgcacggagatgcaggacggcaccttcaccatcaccaac
ttcggggcgttcggcggcgagtacgccaccccgatcatcaaccaccccgagaccgccatc
atggggctcggcgccatcaagcagcggccggtcgtacaggacggcgaggtcgaagcagcc
cacacgctgccgctctccctcgcgatcgaccaccgggtcatcgacggcgcggaagcggca
cagttcaccaacgcggtgaaatcatatctggcggaacccacgaagctactactctaa

DBGET integrated database retrieval system