KEGG   Halophilic archaeon: Halar_2854Help
Entry
Halar_2854        CDS       T01603                                 

Definition
phosphoglucosamine mutase (EC:5.4.2.10)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hah  Halophilic archaeon
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halar_2854
   00030 Pentose phosphate pathway
    Halar_2854
   00051 Fructose and mannose metabolism
    Halar_2854
   00052 Galactose metabolism
    Halar_2854
   00500 Starch and sucrose metabolism
    Halar_2854
   00520 Amino sugar and nucleotide sugar metabolism
    Halar_2854
  Nucleotide metabolism
   00230 Purine metabolism
    Halar_2854
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Halar_2854
Enzymes [BR:hah01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Halar_2854
    5.4.2.8  phosphomannomutase
     Halar_2854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2068242..2069603
Genome map
AA seq 453 aa AA seqDB search
MKVFGSSGTRGVAGEQLTAEFVLRVAKAAGTVWGTERAAVARDTRTTGAMFANAADAGLT
AVGTDVDRLGVTPTPAAVRYAEVEELPAVVITASHNPPEYNGVKLVGADGVELPVADLER
IEQRLLGEEFNIADWDGVGTTRRVDGVNDDYVDDLLANVDHERIADADLTVALDPGHGAG
ALTSPEFFRRLGCDIVTVNGQPDGHFPGREPEPVEENLGDLARLVRATDADVGIAHDGDA
DRAIFFDEHGEYVEGDASLAALATEALSAGDSTVAAVNVSQRLVDVCEAVGAELELTPIG
ATNIITRIQELQAAGERVPISGEGNGGVFFPDFRLVRDGAFIAAKFLELLADAPVSEVIE
PYTAYANVRRNLEYEDENELTAMLDAAETYAREADVTAETVDGYRLDYGDAWVLVRPSGT
EPKVRIYAEARDRGRAAELADAVEAELETSRTA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttttcggctccagcgggacccgcggggtcgccggcgagcaactcacggcggag
ttcgtgctccgcgtcgccaaggccgccggcaccgtctgggggaccgaacgtgccgccgtc
gcccgcgacacccgcaccacgggcgcaatgtttgcgaacgccgccgatgccggcctcacc
gccgtgggcacggacgtcgaccggctgggcgtcaccccgacgcctgcggcggttcgctac
gccgaagtcgaggaactcccagccgtcgtcatcacggcctcacacaacccacccgagtac
aacggcgtcaaactggtcggggccgacggcgtcgaactccccgttgccgacctcgagcgc
atcgagcaacggctgttgggcgaagagttcaacatcgccgactgggacggcgtcgggacg
actcgtcgcgtcgatggcgtcaacgacgactacgtcgacgacctgcttgcgaacgtcgat
cacgaacgaattgctgacgccgacctgaccgtcgccctcgaccccggccacggcgccggg
gcgctcaccagtcccgagttctttcggcggctgggctgtgacattgtcaccgtaaacggc
cagcccgacggccactttcccggccgcgagcccgaacccgtcgaggagaacctcggggac
ctcgcccgactcgtccgcgcgaccgacgccgacgtgggaatcgctcacgacggcgacgcc
gaccgcgccatcttcttcgacgaacacggcgagtacgtcgagggtgacgcctcgctcgcg
gcactggccaccgaggcgctctccgcgggcgattcgaccgtcgccgcggtgaacgtctcc
cagcggctcgtcgacgtgtgcgaggcggtcggcgcggagctcgaactcacacccatcggc
gccaccaacatcatcacccggattcaggaactgcaggccgccggcgagcgcgtccccatc
tccggggagggcaacggcggggttttcttccccgacttccgactcgtgcgggacggcgca
ttcatcgccgcgaagttcctcgaactgctggcggacgcgcccgtcagcgaggttatcgaa
ccctacaccgcctacgccaacgtccggcggaacctcgagtacgaggacgagaacgaactc
acggcgatgctcgacgccgccgagacgtacgcccgggaggccgacgtgacggccgaaacc
gtcgacggctaccgcctcgactacggcgacgcttgggtattggtccgaccctccggcacc
gagccgaaagtccgcatctacgccgaggctcgcgaccgcgggcgggctgccgaactcgcc
gacgccgtcgaagcagaactggagacgtctcgtactgcctag

DBGET integrated database retrieval system