KEGG   Halophilic archaeon DL31: Halar_2854Help
Entry
Halar_2854        CDS       T01603                                 

Definition
(GenBank) Phosphoglucosamine mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hah  Halophilic archaeon DL31
Pathway
hah00010  Glycolysis / Gluconeogenesis
hah00030  Pentose phosphate pathway
hah00051  Fructose and mannose metabolism
hah00052  Galactose metabolism
hah00230  Purine metabolism
hah00500  Starch and sucrose metabolism
hah00520  Amino sugar and nucleotide sugar metabolism
hah00521  Streptomycin biosynthesis
hah01100  Metabolic pathways
hah01110  Biosynthesis of secondary metabolites
hah01120  Microbial metabolism in diverse environments
hah01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halar_2854
   00030 Pentose phosphate pathway
    Halar_2854
   00051 Fructose and mannose metabolism
    Halar_2854
   00052 Galactose metabolism
    Halar_2854
   00500 Starch and sucrose metabolism
    Halar_2854
   00520 Amino sugar and nucleotide sugar metabolism
    Halar_2854
  Nucleotide metabolism
   00230 Purine metabolism
    Halar_2854
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Halar_2854
Enzymes [BR:hah01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Halar_2854
    5.4.2.8  phosphomannomutase
     Halar_2854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_IV PGM_PMM_III Smoothelin
Motif
Other DBs
NCBI-ProteinID: AEN06486
UniProt: G2MH91
Position
2068242..2069603
Genome map
AA seq 453 aa AA seqDB search
MKVFGSSGTRGVAGEQLTAEFVLRVAKAAGTVWGTERAAVARDTRTTGAMFANAADAGLT
AVGTDVDRLGVTPTPAAVRYAEVEELPAVVITASHNPPEYNGVKLVGADGVELPVADLER
IEQRLLGEEFNIADWDGVGTTRRVDGVNDDYVDDLLANVDHERIADADLTVALDPGHGAG
ALTSPEFFRRLGCDIVTVNGQPDGHFPGREPEPVEENLGDLARLVRATDADVGIAHDGDA
DRAIFFDEHGEYVEGDASLAALATEALSAGDSTVAAVNVSQRLVDVCEAVGAELELTPIG
ATNIITRIQELQAAGERVPISGEGNGGVFFPDFRLVRDGAFIAAKFLELLADAPVSEVIE
PYTAYANVRRNLEYEDENELTAMLDAAETYAREADVTAETVDGYRLDYGDAWVLVRPSGT
EPKVRIYAEARDRGRAAELADAVEAELETSRTA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttttcggctccagcgggacccgcggggtcgccggcgagcaactcacggcggag
ttcgtgctccgcgtcgccaaggccgccggcaccgtctgggggaccgaacgtgccgccgtc
gcccgcgacacccgcaccacgggcgcaatgtttgcgaacgccgccgatgccggcctcacc
gccgtgggcacggacgtcgaccggctgggcgtcaccccgacgcctgcggcggttcgctac
gccgaagtcgaggaactcccagccgtcgtcatcacggcctcacacaacccacccgagtac
aacggcgtcaaactggtcggggccgacggcgtcgaactccccgttgccgacctcgagcgc
atcgagcaacggctgttgggcgaagagttcaacatcgccgactgggacggcgtcgggacg
actcgtcgcgtcgatggcgtcaacgacgactacgtcgacgacctgcttgcgaacgtcgat
cacgaacgaattgctgacgccgacctgaccgtcgccctcgaccccggccacggcgccggg
gcgctcaccagtcccgagttctttcggcggctgggctgtgacattgtcaccgtaaacggc
cagcccgacggccactttcccggccgcgagcccgaacccgtcgaggagaacctcggggac
ctcgcccgactcgtccgcgcgaccgacgccgacgtgggaatcgctcacgacggcgacgcc
gaccgcgccatcttcttcgacgaacacggcgagtacgtcgagggtgacgcctcgctcgcg
gcactggccaccgaggcgctctccgcgggcgattcgaccgtcgccgcggtgaacgtctcc
cagcggctcgtcgacgtgtgcgaggcggtcggcgcggagctcgaactcacacccatcggc
gccaccaacatcatcacccggattcaggaactgcaggccgccggcgagcgcgtccccatc
tccggggagggcaacggcggggttttcttccccgacttccgactcgtgcgggacggcgca
ttcatcgccgcgaagttcctcgaactgctggcggacgcgcccgtcagcgaggttatcgaa
ccctacaccgcctacgccaacgtccggcggaacctcgagtacgaggacgagaacgaactc
acggcgatgctcgacgccgccgagacgtacgcccgggaggccgacgtgacggccgaaacc
gtcgacggctaccgcctcgactacggcgacgcttgggtattggtccgaccctccggcacc
gagccgaaagtccgcatctacgccgaggctcgcgaccgcgggcgggctgccgaactcgcc
gacgccgtcgaagcagaactggagacgtctcgtactgcctag

DBGET integrated database retrieval system