KEGG   Halophilic archaeon DL31: Halar_3066Help
Entry
Halar_3066        CDS       T01603                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hah  Halophilic archaeon DL31
Pathway
hah00260  Glycine, serine and threonine metabolism
hah00750  Vitamin B6 metabolism
hah01100  Metabolic pathways
hah01110  Biosynthesis of secondary metabolites
hah01120  Microbial metabolism in diverse environments
hah01230  Biosynthesis of amino acids
Module
hah_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halar_3066
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Halar_3066
Enzymes [BR:hah01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Halar_3066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEN06691
UniProt: G2MHM2
Position
2274322..2275458
Genome map
AA seq 378 aa AA seqDB search
MSTADPAPLACPACGAEYVDRWRCTCGHPLEFARQPLPDGPAPDPASFDTREGLWSFQAF
LPVEQQVSLGEGMTPLEDAPAWDAQFKLEYVFPTGSFKDRGATATLSRALELGVDRVVED
SSGNAGAAIATYAARAGIDAEIYVPASVKQSKLRAIEAAGATPVRVEGSRQDVTDACVEA
AVSEDKGSTGDGQPGDDGASGAWYASHAWNPAFFAGTATVAYETALQRDWEVPDAVVTPL
GHGTLFLGAYRGFRALKAAGWTDSIPRMYGAQAAGYAPIAAELHGTDEGTNDVADGIQIR
DPVQKDAILAAIEETGGDAIALGEEPVADELQRLHGAGFYTEPTCAVAPAALRAYRERGE
IHPDEDVVVPLTGSGLKT
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgccgaccccgcgccgctggcctgtcctgcttgtggcgccgagtacgtcgac
cggtggcgctgcacctgcggccatcccctggagttcgcccgacagccgcttcccgatggg
cccgcacccgaccccgcctcgttcgatacgcgtgagggcctctggagtttccaggcgttc
ctccccgtggagcagcaggtgagcctcggcgaggggatgacgcccctcgaagacgcgcca
gcgtgggacgcccagttcaaactggagtacgtcttccccactggctcgttcaaggaccgc
ggcgccaccgcgacgctctcgcgggcgctggaactcggcgtcgaccgggtcgtcgaggac
tcctcgggcaacgccggagcggctatcgccacctacgcagctcgggcgggcatcgacgcc
gaaatctacgtgcccgcgtcggtcaaacagagcaaactccgagccatcgaggccgccggc
gcgacgccggttcgggtggagggctcccgtcaggacgtgactgatgcctgtgtcgaggcg
gctgtgagcgaggacaaagggtcgaccggtgacggccaaccgggcgacgatggtgccagc
ggcgcctggtacgcctctcacgcgtggaaccccgccttcttcgctgggacggcgacggtc
gcctacgagacggcgctccaacgcgactgggaggtgcccgacgccgtggtcacgccgctg
ggccatgggacgctcttcctcggcgcgtatcgcggattccgcgcgctgaaggcggccggc
tggacagattcgatcccgcggatgtacggcgcacaggccgctggctacgcccccatcgcc
gcggaactccacggcaccgacgagggcacgaacgacgtggctgacggcatccagattcgg
gacccggtacagaaggacgcgattctcgcggccatcgaggagacgggcggcgacgccatc
gcgctgggagaggagccagtcgctgacgaactccagcgactccacggcgctgggttctac
acggagccaacgtgtgcggtggcgcccgcagcactgcgggcgtaccgcgagcgcggggag
attcaccccgacgaggacgtggtcgtcccgttaacggggagtgggctgaaaacatga

DBGET integrated database retrieval system