KEGG   Halophilic archaeon: Halar_3113Help
Entry
Halar_3113        CDS       T01603                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hah  Halophilic archaeon
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halar_3113
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halar_3113
   00052 Galactose metabolism
    Halar_3113
   00500 Starch and sucrose metabolism
    Halar_3113
   00520 Amino sugar and nucleotide sugar metabolism
    Halar_3113
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Halar_3113
   00524 Butirosin and neomycin biosynthesis
    Halar_3113
Enzymes [BR:hah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Halar_3113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2318404..2319366)
Genome map
AA seq 320 aa AA seqDB search
MAWYGGVDLGATNVKAAVGDDAGVVVGQAERPTPTGPDGDAVGAAVVETLVDAAADGGVA
PNELVAVGVGSVGPLDSAAGAVVDSANLPAGIEHVPLVDPLEERFGAEVTLHNDAVAGVI
GERFYADRTPADMAYVTISSGIGAGVTVDGNVLSGWDGNAAEVGHWMVEPGGLPCGCGVD
GHWEAYCSGNNIPQHARHIHETESIETRLPLDSPEFDASTLFAAAGEDPLADRTIEACAE
YNAVGIADLVHAYAPLVVHIGGAVATNNPELVVKPLRERVPELVMSNVPEITLTQLADRV
VVRGALAAAITTDAGDRTKR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggtacggcggcgtcgacctcggagccacgaacgtcaaagcggccgtcggtgac
gacgccggcgtcgtcgtcggacaggccgaacggcccaccccgaccggacccgatggcgac
gctgtcggggcggcagtggtcgagacactcgtggacgcagccgccgacggcggcgtcgcc
cccaacgaactcgtcgccgtgggcgttggtagtgttggcccgctggactcggcagcaggc
gcggtcgtcgattccgccaacctcccagcgggaatcgaacacgtcccgctggtcgacccg
ctggaagagcgcttcggcgccgaggtgacgctgcacaacgacgcggtcgcgggcgtcatc
ggcgagcggttctacgccgaccgtactcccgcagatatggcgtacgtcacgatctcctcg
ggcatcggcgccggcgtcaccgtcgacggcaacgtgctctcgggctgggacggcaacgcc
gccgaggtgggccactggatggtcgagcccggtggcctcccctgtggctgcggggtcgac
ggccactgggaggcctactgctcgggcaacaacatcccccagcacgcccgccacattcac
gagaccgaaagtatcgagaccagactcccgcttgactccccggagttcgacgcatccacc
ctgttcgccgccgccggggaggacccgctggccgaccggacgatagaagcctgtgcggag
tacaacgcagtcggcatcgccgacctggtccacgcgtacgcccccctcgtggtccacatc
ggcggcgctgtcgccaccaacaaccccgaactcgtcgtcaaaccgctccgcgagcgcgtg
cctgagctggtgatgtcgaacgtccccgaaattaccctcacccagcttgcggaccgcgtg
gtcgtccgcggggcgctcgccgccgccatcaccactgatgcaggtgaccggacgaagaga
tag

DBGET integrated database retrieval system