KEGG   Halophilic archaeon DL31: Halar_3113Help
Entry
Halar_3113        CDS       T01603                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hah  Halophilic archaeon DL31
Pathway
hah00010  Glycolysis / Gluconeogenesis
hah00052  Galactose metabolism
hah00500  Starch and sucrose metabolism
hah00520  Amino sugar and nucleotide sugar metabolism
hah00521  Streptomycin biosynthesis
hah01100  Metabolic pathways
hah01110  Biosynthesis of secondary metabolites
hah01120  Microbial metabolism in diverse environments
hah01130  Biosynthesis of antibiotics
hah01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halar_3113
   00052 Galactose metabolism
    Halar_3113
   00500 Starch and sucrose metabolism
    Halar_3113
   00520 Amino sugar and nucleotide sugar metabolism
    Halar_3113
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Halar_3113
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Halar_3113
Enzymes [BR:hah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Halar_3113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: AEN06734
UniProt: G2MMV8
Position
complement(2318404..2319366)
Genome map
AA seq 320 aa AA seqDB search
MAWYGGVDLGATNVKAAVGDDAGVVVGQAERPTPTGPDGDAVGAAVVETLVDAAADGGVA
PNELVAVGVGSVGPLDSAAGAVVDSANLPAGIEHVPLVDPLEERFGAEVTLHNDAVAGVI
GERFYADRTPADMAYVTISSGIGAGVTVDGNVLSGWDGNAAEVGHWMVEPGGLPCGCGVD
GHWEAYCSGNNIPQHARHIHETESIETRLPLDSPEFDASTLFAAAGEDPLADRTIEACAE
YNAVGIADLVHAYAPLVVHIGGAVATNNPELVVKPLRERVPELVMSNVPEITLTQLADRV
VVRGALAAAITTDAGDRTKR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggtacggcggcgtcgacctcggagccacgaacgtcaaagcggccgtcggtgac
gacgccggcgtcgtcgtcggacaggccgaacggcccaccccgaccggacccgatggcgac
gctgtcggggcggcagtggtcgagacactcgtggacgcagccgccgacggcggcgtcgcc
cccaacgaactcgtcgccgtgggcgttggtagtgttggcccgctggactcggcagcaggc
gcggtcgtcgattccgccaacctcccagcgggaatcgaacacgtcccgctggtcgacccg
ctggaagagcgcttcggcgccgaggtgacgctgcacaacgacgcggtcgcgggcgtcatc
ggcgagcggttctacgccgaccgtactcccgcagatatggcgtacgtcacgatctcctcg
ggcatcggcgccggcgtcaccgtcgacggcaacgtgctctcgggctgggacggcaacgcc
gccgaggtgggccactggatggtcgagcccggtggcctcccctgtggctgcggggtcgac
ggccactgggaggcctactgctcgggcaacaacatcccccagcacgcccgccacattcac
gagaccgaaagtatcgagaccagactcccgcttgactccccggagttcgacgcatccacc
ctgttcgccgccgccggggaggacccgctggccgaccggacgatagaagcctgtgcggag
tacaacgcagtcggcatcgccgacctggtccacgcgtacgcccccctcgtggtccacatc
ggcggcgctgtcgccaccaacaaccccgaactcgtcgtcaaaccgctccgcgagcgcgtg
cctgagctggtgatgtcgaacgtccccgaaattaccctcacccagcttgcggaccgcgtg
gtcgtccgcggggcgctcgccgccgccatcaccactgatgcaggtgaccggacgaagaga
tag

DBGET integrated database retrieval system