KEGG   Halophilic archaeon: Halar_3169Help
Entry
Halar_3169        CDS       T01603                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hah  Halophilic archaeon
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Halar_3169
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halar_3169
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Halar_3169
Enzymes [BR:hah01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Halar_3169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2377609..2378481)
Genome map
AA seq 290 aa AA seqDB search
MSRLPEAFADDDPAFIPYLAVGDPDMAASKQYVEALVEGGADCIELGLPFSEPIAEGPTI
QKAVVRSLEGGITPETYLDFIEDLDVDVPLVCMTYYNLLFRYGAEAGTTAGEGDSTAPGP
RGFVKRAAEVGIDGFVIPDLPAEEAEELRAACDEFGLDLVFIVAPSTTDSRLETIRDRVS
GYVYVQARLGVTGAQADVSDQTAESLARISDWDVPKAVGFGISTGDHAARVIEAGADGII
VGSALVDIIAEGAAEQRSTAAVAADLREKARELKQGAVRGGKRRRVTESE
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagccggctccccgaggcgttcgccgacgacgaccccgcgttcatcccctatctcgcg
gtgggcgacccggacatggctgcgtccaagcagtacgtcgaggcgcttgtcgagggcggt
gcggactgcatcgaactcggcctgccgttctcggaacccatcgccgaggggccgaccatc
cagaaggcggtcgtccgctcgctggagggcggtatcacgcccgagacctacctcgatttc
atcgaggacctcgacgttgacgtgccgctggtctgtatgacctactacaacctcctcttc
cgctacggcgccgaggccggcaccacggcaggcgagggtgactccaccgccccaggaccg
cgggggttcgtgaagcgcgctgcagaggtgggcatcgacggcttcgtcatccctgacctg
cccgccgaggaagctgaagaactccgggcggcctgtgatgagttcggcctggacctcgtg
ttcatcgtcgcgccctcgactaccgacagccggctcgaaaccatccgcgaccgcgtctcg
ggctacgtctacgtgcaggcccggctgggcgtgacgggcgcgcaagccgacgtctctgac
cagaccgccgagagccttgcccggatttcggactgggacgtccccaaagcggtcggcttc
ggtatctctacaggtgatcacgccgcccgagtgattgaggctggcgccgacggcatcatc
gtcggctccgcactcgtcgacattattgcggagggggccgcagaacaacgctcgaccgca
gccgtcgccgccgacctgcgcgagaaagcccgcgaactcaaacagggtgccgtccgcggc
ggcaaacgccgccgagtgaccgagtccgagtag

DBGET integrated database retrieval system