KEGG   Halophilic archaeon: Halar_3170Help
Entry
Halar_3170        CDS       T01603                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hah  Halophilic archaeon
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Halar_3170
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halar_3170
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Halar_3170
Enzymes [BR:hah01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Halar_3170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2378478..2379764)
Genome map
AA seq 428 aa AA seqDB search
MSSDTGSDDGKFGEYGGQYVPEALMPAIEELSDAYRRYVLENEDGFMDEFRKRLREFGGR
PTPLQHAEHLSDRYDRAVYLKREDLLHGGAHKLNNALGQVLLAKYMGKERIIAETGAGQH
GTATAMAAAHLDIPCEIYMGETDINRQRPNVFRMRINGAELNPVTAGRGTLKEAISETMR
DWATNVADTHYVVGSVVGPAPFPAMVRDFQSVISEEVRTQSEAKFGEQPDSVVACAGGGS
NTMGAFAHYRKDHDVNLLAVEAGGSSLAVDEEEGVAPNSASLSTGGQGILHGARTKVLQD
SWGQIMESHSVSAGLDYAGVGPELAYLVDQGRVSAVTVDDDAALEAFHRCSQLEGVIPAL
ESSHALAYLEETLGPNAEATDEAVEEFGETIVINLSGRGDKDLETVIEETDKRDIPNAPD
MSEFAGGL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagttctgatacagggagtgacgacgggaagttcggggagtacggtggccagtacgtg
cccgaggcgctgatgccggctatcgaggagctatctgacgcctaccggcgctacgtactg
gaaaacgaagacggcttcatggacgagttccggaagcgcctgcgggagttcggcggtcga
cccacgccgctccagcacgctgagcacctctcggatcgctacgaccgtgcggtctacctc
aagcgcgaggacctgctccacggcggcgcccacaaactcaacaacgccctcggccaggtg
ctgctggcgaagtatatgggcaaggagcgcattatcgccgagaccggcgccggtcagcac
ggcacggcgacggcgatggcggccgcccacctcgacataccctgcgagatctacatgggc
gagaccgacatcaaccgccagcgacccaacgtcttccggatgcgcatcaacggggcggaa
ctcaaccccgtcaccgcgggccggggcacactcaaagaggccatcagcgagacgatgcgt
gattgggccaccaacgtcgccgacacccactacgtcgtcggcagcgtcgtcggccccgca
ccgttccccgcgatggtccgggatttccagtcggtcatcagcgaggaggtccgcacccag
agcgaagccaagttcggcgaacagcccgattccgtcgtcgcctgcgcgggcggcggctcg
aacacgatgggcgcgttcgcacactatcgcaaggaccacgacgtgaacctcctcgcagtc
gaggctggcggctcctcgctggccgtcgacgaggaggagggcgtcgcacccaactctgcg
tcgctctcgacgggcggacagggcatcctccacggcgcccgcacgaaagtgctgcaggat
agttggggccagattatggagtcccactccgtctcggcagggctggactacgccggcgtc
gggccggagctggcctacctcgtcgaccagggccgcgtctcggcggtcaccgtcgacgac
gacgcggcgttggaggcgttccaccggtgctcccaactcgagggcgtcatcccggcgctc
gagagctcccacgcgctggcgtacctcgaagagacgctcggcccgaacgccgaggccacc
gacgaggccgtcgaagaattcggcgagactatcgtcatcaacctctcggggcgcggcgac
aaggacctcgagacggttatcgaggagaccgacaaacgagacatcccgaacgcgccggat
atgagcgagttcgcggggggactatga

DBGET integrated database retrieval system