KEGG   Halophilic archaeon: Halar_3213Help
Entry
Halar_3213        CDS       T01603                                 

Definition
aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
Orthology
K02434  
aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
hah  Halophilic archaeon
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:hah00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2420735..2422222
Genome map
AA seq 495 aa AA seqDB search
MSQTLQDRELAAVIGLEVHVQLETDTKIFCGCSTAAAEDEAPNSRTCPTCLGLPGALPVL
NEAAVESAVKIGKALDAEIPEETTFHRKNYFYPDLPKGFQLTQYDAPICADGELELRVEG
DRRTISVRRAHLEEDPGSLQHEGGNIDTADYTLINYNRAGTPLMEIVTRPDFRSPAETRA
FLAKLEEVLEYLGVFDATRDGSLRVDANISMVAADDVAEDGTISEEVLESANRTEVKNIS
SHKAAEDALAYEVTRQRNAVKRGRAVEQETRHWDESRGVTVSMRSKEEEKDYRYFREADL
PPLQVADWKERIPIPELPDARRQRFQTEYGLSQEAASKLTSRKSVADLYEEVAETFDPGL
AATWVADNLIGELNYRDMVVADITDRLDEFEELVRLVAEDEVTTKNAEEIVFRRMLDEGE
SPQEIIEAEGLGKASGGEVEQAVAEAIEENPEAVADYESGDDGALNFLVGQVMQKTGGSA
DPGQVNQLLREELEG
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagacgctccaggaccgcgaactcgcggccgtcatcggactggaggtccacgtc
cagttggagaccgacaccaagatcttctgtggctgctctacggcggctgccgaggacgag
gcgcccaacagtcggacctgccccacctgtcttggcctgccaggcgcgttgcccgtgctc
aacgaggcggccgtcgagtcagcggtgaaaatcggaaaggcactcgacgccgagatcccc
gaggagaccacattccaccggaagaactacttctaccccgacctcccgaaagggttccag
ctcacccagtacgacgcgccaatctgtgccgacggcgagttggaactccgcgtcgagggc
gaccgccgaaccatcagcgtccgccgcgcccacttggaggaggaccccggcagcctccag
cacgagggcggcaacatcgacaccgctgactacaccctcatcaactacaaccgcgcgggc
acgccgctgatggagattgtcacccgaccggacttccgctcgccggccgagacccgcgca
ttcctcgccaaactcgaggaggtgctcgagtatctgggcgttttcgacgccacccgcgac
ggctcgctccgtgtggacgccaacatctccatggtcgccgccgacgacgtggccgaggac
ggcaccatcagcgaggaggtcctcgagagcgccaaccgaaccgaagtcaagaacatctcc
agccacaaggccgccgaggacgcgctggcctacgaagtcacccgccagcgcaacgcggtc
aagcgcgggcgcgcggtcgagcaggagacccgccactgggacgagagccggggcgtcacc
gtctcgatgcgctcgaaagaggaggagaaagattaccgctacttccgggaggccgacctc
ccgccgctccaggtggccgactggaaagagcgcatccccattcccgaactccccgatgcc
cgccgccagcggttccagactgagtacgggctgagtcaggaagccgcctcgaagctcacc
tcccggaaatccgtcgccgacctctacgaagaagtggccgaaacgttcgaccccggcctc
gcggcgacgtgggtcgcagacaacctcatcggcgaactcaactaccgcgacatggtggtg
gccgacatcacggaccgcctcgacgagttcgaggaactggtccgactggtggcagaagac
gaagtcaccaccaagaacgccgaggagatcgtgttccgccggatgctcgacgagggcgag
tcgccacaggaaatcatcgaggccgaagggctcggcaaagccagcggcggcgaggtcgag
caggctgttgctgaagcgatcgaggagaaccccgaggccgttgccgactacgagtccggc
gacgacggcgcactcaatttcttagtgggccaggtgatgcagaagaccggtggctcggcc
gaccccggccaggtgaatcagttgctgcgtgaggaactcgaaggctga

DBGET integrated database retrieval system