KEGG   Halophilic archaeon: Halar_3321Help
Entry
Halar_3321        CDS       T01603                                 

Definition
Agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
hah  Halophilic archaeon
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Halar_3321
Enzymes [BR:hah01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Halar_3321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2520969..2521985)
Genome map
AA seq 338 aa AA seqDB search
MSRGPDRSRAAEFRNRTTGADVELAYAGIDTFLKADLAEIDDVGGADAAVLGAPYDGAVS
NRPGARYGPDAVREASAWWAYLSGYKGGLTNMRTGEQVDYGDLSVVDTGDVPVFPMDCET
TADSIAAHVATIAAQGTMPVLIGGDHYCTFPAVRGFAEGADLDSVGLVQIDAHTDTVAES
AVFGEHFHGSSTHHIADSEFADYANVSQVGIRGYESPAFFEFADETGLNLFTMNEVNERG
IGPVTEAAVEAAADGTDAVYVTFDIDSVDPSDAPGTGTPEPGGLSADQALTVMETLGAHD
SVAAADLMEVAPDHDPAGNTSRLAANLLVALLERKFAV
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcggccccgaccgctcgcgcgcagccgagttccgcaaccgcacgactggcgcc
gatgtcgaactcgcctacgcgggcatcgacacgttcctgaaagccgacctcgcggagatc
gacgacgttggcggtgccgacgctgcggtgctcggcgcgccctacgacggcgccgtgtcg
aaccgcccgggtgcccgctacggccccgatgctgtccgggaggcaagcgcgtggtgggcc
tacctctcgggctacaagggggggctgaccaacatgcgcaccggcgagcaggtggattac
ggcgacctctcggtggtcgataccggcgacgtaccggtgttcccgatggactgcgagacg
acagccgactctatcgctgcccacgtcgcaaccatcgccgcccaggggaccatgccggtg
ctcatcggcggcgatcactactgcaccttcccggcggttcgtggcttcgccgagggagcc
gaccttgactccgtgggcctcgtccagattgacgcccacaccgacaccgttgcggagtcg
gcggtgttcggcgagcatttccacggctcctcgacccaccacatcgcggactccgagttc
gccgactacgcgaacgtctcgcaggtcggcatccgagggtacgagtcgccagcgttcttc
gagttcgccgacgagacggggctgaacctcttcacaatgaacgaggtgaacgagcgcggc
atcggccccgtgaccgaggcagcggtcgaggctgcggccgacggcaccgacgcggtctac
gtcaccttcgacatcgactcggtggacccgagcgatgcgccggggacgggtactccggag
ccgggtggcctctcggctgaccaggcgctcacggtgatggagacgctcggcgctcacgat
tctgtcgcggctgcggacctgatggaggtcgcgcccgatcacgaccccgcgggcaacacc
tcacggctggcggcgaatctgctggtggcgctgctggagcggaagttcgcggtgtaa

DBGET integrated database retrieval system