KEGG   Halophilic archaeon: Halar_3369Help
Entry
Halar_3369        CDS       T01603                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hah  Halophilic archaeon
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Halar_3369
Enzymes [BR:hah01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Halar_3369
Exosome [BR:hah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Halar_3369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2568766..2569779
Genome map
AA seq 337 aa AA seqDB search
MERPHRSSPLGRDDARRPRRLRADGIRSLVSERSLSAADLIAPIFIDATTEQRQPIESMP
GHERVPLKAAVPRVEEVLATGVEAVMLFGIPESKDERGSRAYAEDGVVQAAVRQVTAETD
AYVITDVCLCEYTDHGHCGVVETDAHDDPELTVKNDESLDLLAKTAVSHAEAGADMVAPS
ASLDGMVGAIRQELDEAGFENCPIMSYAAKYESAFYGPFRDAADGAPAFGDRRHYQMDPA
NSREARREVELDVTEGADVLMVKPALPYLDIVAQVRRDHDHPVAAYNVSGEYAMVHAAGE
KGWLDLEAVAQESLLSIKRAGADLILTYFAEDVAAAL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggagcgaccccaccgttcgtcgccgctgggccgcgacgacgcgcgccgcccgcgccgc
ctgcgcgccgacggcatccgctcgctcgtcagtgaacgttcgctgtcggctgcggatctg
atcgccccgattttcatcgacgccacgaccgagcagcgccagcccatcgagtcgatgccg
ggtcacgagcgcgtgcccctcaaggcggccgtcccgcgagtcgaggaggtgctcgcaacg
ggcgtcgaggcggtgatgctgttcggcatccccgagtccaaggacgaacgcggcagtcgc
gcgtacgccgaggacggcgtcgtacaggcggctgtccgacaggtgaccgcagaaacggac
gcctacgtgattacggacgtctgtctttgtgagtacaccgaccacggtcactgtggcgtc
gtcgaaaccgacgcccacgacgacccagaactgacggtgaaaaacgacgagagcctcgat
ctcctcgcgaagaccgcagtctcccacgcggaagcgggcgcggacatggttgcaccctct
gccagcctggacgggatggttggcgccatccggcaggagcttgacgaggcgggcttcgag
aactgtccgatcatgtcctacgcggcgaagtacgaatcggcgttctacggcccgttccgg
gacgccgccgacggcgcgccggcattcggcgaccgtcgccactaccagatggacccagct
aacagccgggaggcccgccgcgaggtcgaactcgacgtgacggagggtgctgacgtgctg
atggtcaagcctgcgctcccgtatctggatatcgtcgcgcaggtgcgccgtgaccacgac
cacccggtcgcagcctacaacgtctccggggagtacgcgatggtgcacgccgccggcgag
aagggctggcttgacctcgaagccgtcgcacaggagtcgctgctctcaatcaaacgagcc
ggtgcagatctgattctgacctacttcgccgaagacgtggcggcagcgctatag

DBGET integrated database retrieval system