KEGG   Halophilic archaeon: Halar_3533Help
Entry
Halar_3533        CDS       T01603                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hah  Halophilic archaeon
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halar_3533
   01230 Biosynthesis of amino acids
    Halar_3533
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halar_3533
   00051 Fructose and mannose metabolism
    Halar_3533
   00562 Inositol phosphate metabolism
    Halar_3533
Enzymes [BR:hah01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Halar_3533
Exosome [BR:hah04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Halar_3533
  Exosomal proteins of bladder cancer cells
   Halar_3533
  Exosomal proteins of melanoma cells
   Halar_3533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2734155..2734799)
Genome map
AA seq 214 aa AA seqDB search
MFVLVNLKAYDCDAVSVAETAADVASDTGARIAVAPQPAELTAVAETGVETWAQHVDPIP
HGSHTGSVHAASVAAAGATGTLLNHSERRLKLADIDAGLGAAEAAGLDTVVCANNPDQVG
SAAALGPDAVAVEPPELIGGDVSVASADPDIVTNAVVAAADANPAVDVFCGAGIATGADV
AAAAELGADGVLLASGVALAADPDAVLRDLVSSL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttctcgtcaatctgaaagcgtacgactgcgacgcagtctcggtcgccgagaca
gccgccgacgtcgcttccgacaccggcgccagaatcgctgttgctccccagccggcagag
ctcacggccgtcgccgaaacgggcgtcgagacgtgggcccagcacgtggacccgattccc
cacgggagtcacaccggaagcgttcatgccgcctcagtcgccgcagcaggtgccacggga
actctactcaaccactccgagcggcggctgaaactcgccgacatcgatgctggcctcggt
gccgcggaggcggccggcctggacactgtcgtctgtgcgaacaaccctgaccaggtaggg
tcagccgccgcgctcggccccgatgccgtcgccgtcgagccgcccgaactcatcggtggt
gacgtgtctgttgccagcgctgacccggatatcgtcaccaacgctgtcgtggcggccgcc
gacgcgaacccggcagtcgatgtcttctgtggcgcaggaatcgcgacaggagcggacgtt
gcggctgctgcggagcttggtgccgacggcgtcctgctggcctctggtgtcgcgctcgca
gcggacccagacgcggtgcttcgtgatctcgtctcgtcgctctga

DBGET integrated database retrieval system