KEGG   Halophilic archaeon DL31: Halar_3698Help
Entry
Halar_3698        CDS       T01603                                 

Definition
(GenBank) Glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
hah  Halophilic archaeon DL31
Pathway
hah00010  Glycolysis / Gluconeogenesis
hah01100  Metabolic pathways
hah01110  Biosynthesis of secondary metabolites
hah01120  Microbial metabolism in diverse environments
hah01130  Biosynthesis of antibiotics
hah01200  Carbon metabolism
hah01230  Biosynthesis of amino acids
Module
hah_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hah00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halar_3698
Enzymes [BR:hah01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Halar_3698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N NAD_binding_3 2-Hacid_dh_C Sacchrp_dh_NADP GFO_IDH_MocA TrkA_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AEN07272
UniProt: G2MNC4
Position
complement(2873402..2874433)
Genome map
AA seq 343 aa AA seqDB search
MTQVGVVGYGTIGKRVADAVVAQRDMDLVGVAKTSPNFEAEAALAKGYDLYAAVPERRER
FDEAGMAVAGDLDALVDSVDVIVDATPSGIGAKNKESYEAHDTPAIYQGGEDAEVADTSF
NARANFEQAEDADHVRVVSCNTTGLSRLLAPLREEYGVEKARVTLVRRGGDPGQTDRGPI
NDIIPDPVSLPSHHGPDVKTIFPDIAIDTLGLKVPTTLMHMHSVNVTLESETDAEAVKEL
FAEESRLFLVPEAAGIDGAGKLKEFALDAGRSRGDIWENCIWAESIAVRGRDLYLFQAIH
QESDVVPENVDAIRAITGSASKAESIATTNETIGMGLGRAFER
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggtcggcgtcgtcggatacggtaccatcggaaagcgcgtggccgatgctgtt
gtcgcacagcgagatatggatctcgttggggtcgcaaagacctcaccgaacttcgaggct
gaagccgccctcgccaaggggtatgacctctatgcggcagtccccgaacgccgcgagcgg
ttcgacgaggccgggatggccgtcgccggcgacctcgacgcgttggtcgatagcgtcgac
gtcatcgtcgacgccaccccgagcggcattggcgccaaaaacaaggaaagctacgaggcc
cacgacaccccggctatctaccagggcggcgaggacgccgaggtggccgacacctcgttc
aacgcccgtgcgaacttcgagcaggccgaggacgcggaccacgtacgtgtggtctcctgc
aatacgaccgggctctcgcgcctgctcgcgccgctccgcgaggagtacggcgtggagaag
gcccgtgtgacgctggtccgtcgcggcggcgaccccggacagaccgaccgcggtcccatc
aacgacatcatcccggaccccgtctcgctcccgagccaccacggccccgacgtgaagacc
atcttccccgacatcgctatcgacacgctggggctgaaggtgcccacgacgctgatgcac
atgcactcggtgaacgtcacgctggagagcgaaaccgacgcagaggcggtgaaagagctc
tttgctgaggagtcgcggctgttcctcgtgcccgaggcggccggcatcgacggcgctggc
aaactcaaggagttcgcactcgacgcgggccgctcccgtggcgatatttgggagaactgc
atctgggccgaatccatcgcggtgcggggcagggacctctatcttttccaggcaattcac
caagagtccgacgtggttccagagaacgtcgacgcgattcgggcgattacggggtcggcg
agcaaagccgagagcatcgcgacgaccaacgagaccatcgggatggggttgggccgagcg
ttcgagcggtaa

DBGET integrated database retrieval system