KEGG   Hipposideros armiger (great roundleaf bat): 109378177Help
Entry
109378177         CDS       T04661                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Brite
Enzymes [BR:hai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     109378177
Peptidases [BR:hai01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   109378177
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109378177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 241 aa AA seqDB search
MWYEDALASSYPIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSIGTPSE
QGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERETPPDALILESPFTN
IREEAKSHPFSVIYRYFPGFDWFFLDPITSSGIKFANDENMKHISCSLLILHAEDDPVVP
FQLGRKLYNIAAPSRSFQDFKVQFIPFHSDLGYRHKYIYKSPELPRILREFLGKAEPGHQ
H
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtggtatgaggatgccttggcttccagttaccctatcattctgtacctgcacggtaat
gcaggcaccagaggaggtgaccaccgagtggagctttacaaggtactgagttcacttggt
taccatgtggtcacctttgactacagaggttggggtgactcaataggcacaccatcggaa
cagggcatgacctatgatgcactccatgtttttgactggatcaaagcaagaagtggggac
aaccctgtgtatatttggggccactccctaggcactggagtggcaacaaatctggtacgg
cgcctctgtgagcgagagacgcctccagatgcccttatactggaatctccattcactaat
atccgcgaagaagctaagagccatccgttctcagtgatatatcgctacttccctgggttt
gactggttcttcctcgatcccattacaagcagtggaattaaatttgcaaatgatgaaaac
atgaagcacatctcctgctccctgctcatcttacacgccgaggacgacccggtcgtgccc
tttcagcttggcagaaagctctacaacatcgctgcgccatctcgaagcttccaagatttc
aaagttcagtttatcccctttcactcagaccttggctacaggcataagtacatctacaag
agccctgagcttcctcggatactgagggaattcctggggaaggcggaacctgggcaccag
cactga

DBGET integrated database retrieval system