KEGG   Hipposideros armiger (great roundleaf bat): 109388234Help
Entry
109388234         CDS       T04661                                 

Gene name
ABHD6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:hai00001]
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    109388234 (ABHD6)
Enzymes [BR:hai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     109388234 (ABHD6)
Peptidases [BR:hai01002]
 Serine Peptidases
  Family S33
   109388234 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 221 aa AA seqDB search
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIKIYYCFFQNLRQLWADTRSSQCKMG
LGMKVDALPSCFGMNPTGLQYPRDTQFMQRLRELKDSAAVEKIPLIPSTPEEMSEMLQLC
SYVRFKVPQQGPKNHRCQVSVGVCPPSAHRHLNLFHLVSSLVLQVLDVSGADVLAKSIAN
CQVELLENCGHSVVMERPRKAAKLIVDFLASVHNTDSKKLD
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggaccttgacgtggtgaacatgtttgtgatcgcaggcgggacgctggccatcccaatc
ctggcatttgtagcctcgtttctcctgtggccttcagcactgatcaagatctattattgt
tttttccaaaatctaagacagctctgggctgatactagaagttcccaatgtaaaatgggg
cttggtatgaaggtagatgcattgccaagctgttttggtatgaatcccacaggcctgcaa
tacccaagggatactcagttcatgcaacggctcagagaactgaaggactctgccgccgta
gagaagattcccttgatcccatccaccccagaagagatgagtgaaatgctccagctttgc
tcctatgtccgcttcaaggtgccccagcagggccctaaaaaccatcgctgccaggtctca
gtaggagtctgtccaccaagtgcacacaggcatctgaaccttttccatctagtttcctct
cttgtcctgcaggtgctcgatgtgtctggggcagacgtgttggccaagtccatcgccaac
tgccaggtagaacttctggaaaactgtgggcactcggtggtaatggagagacccaggaag
gcagccaagctcattgtcgactttttagcttctgtacacaacacagacagcaagaagctg
gactga

DBGET integrated database retrieval system