KEGG   Hipposideros armiger (great roundleaf bat): 109396062Help
Entry
109396062         CDS       T04661                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04010  MAPK signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04022  cGMP-PKG signaling pathway
hai04066  HIF-1 signaling pathway
hai04068  FoxO signaling pathway
hai04072  Phospholipase D signaling pathway
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04152  AMPK signaling pathway
hai04211  Longevity regulating pathway
hai04213  Longevity regulating pathway - multiple species
hai04520  Adherens junction
hai04910  Insulin signaling pathway
hai04913  Ovarian steroidogenesis
hai04923  Regulation of lipolysis in adipocytes
hai04930  Type II diabetes mellitus
hai04931  Insulin resistance
hai04932  Non-alcoholic fatty liver disease (NAFLD)
hai04960  Aldosterone-regulated sodium reabsorption
Module
hai_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:hai00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    109396062 (INSR)
   04015 Rap1 signaling pathway
    109396062 (INSR)
   04010 MAPK signaling pathway
    109396062 (INSR)
   04066 HIF-1 signaling pathway
    109396062 (INSR)
   04068 FoxO signaling pathway
    109396062 (INSR)
   04072 Phospholipase D signaling pathway
    109396062 (INSR)
   04022 cGMP - PKG signaling pathway
    109396062 (INSR)
   04151 PI3K-Akt signaling pathway
    109396062 (INSR)
   04152 AMPK signaling pathway
    109396062 (INSR)
   04150 mTOR signaling pathway
    109396062 (INSR)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    109396062 (INSR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    109396062 (INSR)
   04923 Regulation of lipolysis in adipocyte
    109396062 (INSR)
   04913 Ovarian Steroidogenesis
    109396062 (INSR)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109396062 (INSR)
  Aging
   04211 Longevity regulating pathway - mammal
    109396062 (INSR)
   04213 Longevity regulating pathway - multiple species
    109396062 (INSR)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    109396062 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    109396062 (INSR)
   04931 Insulin resistance
    109396062 (INSR)
Enzymes [BR:hai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109396062 (INSR)
Protein kinases [BR:hai01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   109396062 (INSR)
CD molecules [BR:hai04090]
 Proteins
  109396062 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Recep_L_domain Pkinase_Tyr Furin-like Pkinase fn3 B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 109396062
NCBI-ProteinID: XP_019523149
Position
Un
AA seq 1167 aa AA seqDB search
MDAGGRRGATAAPMLVAVAALLVGAAGHLYPGEVCPGMDIRNNLTRLHELANCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMVTDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTAKGKTNCPATVINGQFVERCWTHNHCQKVCPTICKSHGCTAEGLCCHSECL
GNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHNKCKNSRRQG
CHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC
TVVNGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGDTL
EVGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSFIRTSYDKIMLKWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPRWLMWGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTNATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWE
RQAEDSELYELDYCLKGLKLPSRTWSPPFESEGSQKHNQSEHEASAGECCSCPKTDSQIL
KELEESSFRKTFEDYLHNVVFVPRPSRKRRALGDVANVTTVMPTAAAFPNTSSTSTPTSS
EEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDSPEERCSVAAYVSARTMPEAKADD
IVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCR
LRGLPPGNYSVRVRATSLAGNGSWTEATYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVI
GSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVRSSVPCSVYVPDKWEVPQEKIALLREL
GQGSFGMVYEGNARDIVKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRL
LGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAY
LNAKKFVHRDLAARNCMVAHDFTVKIG
NT seq 3502 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgggggcaggcggggggcgaccgccgcgcctatgctggtggctgtggccgcg
ctgctggtgggcgccgcgggccacctgtatcctggagaggtgtgccccggcatggatatc
cggaacaacctcacaaggttgcacgagctggccaactgctccgtcatcgaaggacatttg
cagatactattgatgttcaaaacgaggcccgaggatttccgagacctcagtttccccaaa
ctcatcatggtcactgattacttgctgctgttccgggtctatgggctggagagcctgaag
gacctgttccccaacctcacagtcatacggggctcccgtctcttcttcaactatgcgctg
gtcatcttcgagatggttcacctgaaggagcttggcctctacaacctgatgaacatcacc
cggggctctgtccgcatcgagaagaacaatgagctctgctacctggccaccatcgactgg
tcacgcatcctggattcggtggaggataattacattgtgctgaacaaagatgacaacgag
gaatgtggggacatctgtccaggcactgcgaagggcaagaccaactgccctgccaccgtc
atcaacgggcagtttgttgagcggtgttggactcacaaccattgccagaaagtctgcccc
accatctgtaagtcgcacggctgcaccgccgaaggcctctgctgccacagcgagtgcctg
ggcaattgctctgagcccgatgaccccaccaagtgcgtggcctgccgcaacttctatctg
gacggcaggtgtgtggagacctgcccgcccccgtactatcacttccaagactggcgctgc
gtgaacttcagcttctgccaggacctgcacaacaaatgcaagaattctcggaggcagggc
tgccaccagtatgtcattcataacaacaagtgcatccctgagtgtccctctgggtacacg
atgaattctagcaacttgatgtgcactccgtgtctgggcccctgtcccaaggtctgtcac
ctcctagaaggcgagaagaccatcgactcagtgacgtctgcccaggagctccgaggctgc
accgttgtcaatggaagccttatcatcaacattcgaggcggcaacaacctggcagctgag
ctagaggccaacctcggccttattgaggaaatttcagggtatctgaaaatccgccgttcc
tatgccctcgtgtcactttccttcttccggaagttacgtctgattcggggggataccttg
gaagtcgggaactactctttctacgccttggacaaccagaacctaaggcagctgtgggac
tggagcaaacacaacctcaccatcactcaggggaaacttttcttccattataatcccaaa
ctctgcttgtcggaaattcacaagatggaggaagtttcaggaacgaaggggcgccaggaa
aggaatgacattgccctgaagaccaatggggaccaggcgtcctgtgaaaatgaattactt
aaattttcttttattcggacatcttatgataagatcatgctgaaatgggagccatactgg
ccccctgacttccgagacctcctggggttcatgctgttctacaaagaggccccttatcag
aatgtgacggagttcgatgggcaggatgcgtgtggctccaacagctggacagtggtggac
attgaccctcctctgaggtccaatgaccctaagtcacagaaccatcccagatggctgatg
tggggtttgaagccctggacccagtatgccatctttgtcaagaccttggttaccttttct
gatgaacgtcgcacatatggggccaagagcgacatcatctatgtccagacaaatgccacc
aatccttctgtccccctggatcccatctcggtttctaattcctcatcccagattatcctg
aagtggaagcctccctctgaccccaacggcaacatcactcactacctggttttctgggag
aggcaggcagaagacagtgagctgtacgagttggattattgcctcaaagggttgaagctg
ccctcccggacctggtctccaccgttcgagtcggagggttcccagaagcacaaccagagt
gagcacgaggcatctgcgggcgagtgttgctcctgcccgaagaccgactctcagatcctg
aaggagctggaggagtcctcgttccggaagacgtttgaggactacctgcacaacgtggtc
ttcgtccccaggccatcgaggaaacgcagggcccttggtgacgtggcaaatgtgacaacg
gtcatgcccacagctgctgctttccccaatacctcctcgaccagcacgcccacgagctcg
gaggagcaccggcccttcgagaaagtagtgaacaaagagtctctggtcatctccggcctg
cgccacttcactggctatcgcatcgagctacaggcttgcaaccaagattcccctgaggaa
agatgcagcgtagcggcctatgtcagtgccaggaccatgcccgaagccaaggcagatgac
attgttggtcccgtgacccatgaaatcttcgagaacaatgttgttcacttgatgtggcag
gagccgaaggaacccaatggtctgattgtgctgtacgaagtgagttatcgacggtacggc
gatgaggagctgcacctctgtgtctcccgcaagcatttcgctctggagcggggctgcagg
ctgcgcgggctgcctccggggaattacagcgttcgagtccgggccacctccctggcgggc
aacggctcctggacagaagccacctatttctatgtgacagactatttggacgtcccatcg
aatattgcaaaaattatcattggccccctcatctttgtcttcctcttcagtgttgtgatt
ggaagtatttatctattcctgagaaagaggcagccggatgggccgctgggaccgctgtat
gcttcttcaaaccctgagtacctcagtgccagcgatgtgaggagtagtgttccctgttct
gtgtatgtgccagacaagtgggaggtgccccaggagaagatcgccctcctgcgagagctg
ggccagggctccttcggcatggtgtatgagggcaacgccagggacatcgtcaagggcgag
gcagagacccgcgtggcagtgaagacagtcaacgagtcggccagtctgcgtgagcggatt
gagtttctcaacgaggcctcggtcatgaagggcttcacctgccatcatgtggtccgcctc
ctgggggtggtgtccaaagggcagccaacactggtggtgatggagttgatggctcatgga
gacctgaagagctacctccgttccctgcggcctgaagctgagaataatcccggccgccct
cccccgaccctgcaagagatgattcagatggcagcagagatcgccgacgggatggcatac
ctgaatgccaagaagtttgtgcaccgggacctcgcagctcgaaactgcatggtcgcccac
gattttaccgtcaaaatcggag

DBGET integrated database retrieval system