KEGG   Halomonas sp. KO116: KO116_02116Help
Entry
KO116_02116       CDS       T03800                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hak  Halomonas sp. KO116
Pathway
hak00071  Fatty acid degradation
hak00072  Synthesis and degradation of ketone bodies
hak00280  Valine, leucine and isoleucine degradation
hak00310  Lysine degradation
hak00362  Benzoate degradation
hak00380  Tryptophan metabolism
hak00620  Pyruvate metabolism
hak00630  Glyoxylate and dicarboxylate metabolism
hak00640  Propanoate metabolism
hak00650  Butanoate metabolism
hak00900  Terpenoid backbone biosynthesis
hak01100  Metabolic pathways
hak01110  Biosynthesis of secondary metabolites
hak01120  Microbial metabolism in diverse environments
hak01130  Biosynthesis of antibiotics
hak01200  Carbon metabolism
hak01212  Fatty acid metabolism
hak02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hak00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KO116_02116
   00630 Glyoxylate and dicarboxylate metabolism
    KO116_02116
   00640 Propanoate metabolism
    KO116_02116
   00650 Butanoate metabolism
    KO116_02116
  Lipid metabolism
   00071 Fatty acid degradation
    KO116_02116
   00072 Synthesis and degradation of ketone bodies
    KO116_02116
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KO116_02116
   00310 Lysine degradation
    KO116_02116
   00380 Tryptophan metabolism
    KO116_02116
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KO116_02116
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KO116_02116
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KO116_02116
Enzymes [BR:hak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KO116_02116
Exosome [BR:hak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KO116_02116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJY50593
UniProt: A0A0D5M479
Position
complement(2266986..2268194)
Genome map
AA seq 402 aa AA seqDB search
MQDAYIYDGLRTPFGRHGGSLAAIRPDELLGLTLKALVARNPFAPESYEEVLAGCTNQAG
EDSRNVARHGALLAGLPIEVAGQTVNRLCGSGLAAMMDAARAARLGEGELFLAGGVESMS
RAPYVLGKADSPFARNQPMFDTVIGSRFPNPWIAKEYGSHSMPETADNIAHDLNIGRDAS
DAFAARSQARYAQSLAAGFYDGEMLGVEVPQVRKQPPLLVDKDEHPRPQSTEDKLAKLAA
LFEGGVVTAGNASGLNDGAAALIVGTQAAGERVGLTPRARIVASAVAGVAPRVMGLGPVP
ASQKALARAGLTLEQMDVIEINEAFAVQVLGCVQQLGLSVDDPRLNANGGAIAIGHPLGA
SGARLALTALRQLETTGGRYALVTMCIGVGQGIATIIERLDS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgcctatatttacgacggtttacgcaccccttttggccgccacggtggcagc
ttggcggctattcgccccgatgaactgctggggctgacgctgaaagcgctggtcgcccgc
aacccctttgcgccggaaagctatgaagaggtgttggcaggctgcaccaaccaggcaggt
gaagactcccgtaacgtggcccgccacggtgcattgttggcaggcctgcctattgaagtg
gcgggccaaaccgtcaaccggctttgtggtagtggcttggcggcgatgatggatgctgcc
cgggcagctcgactgggtgaaggcgagctgtttttggccggtggcgttgagtccatgtcc
cgcgcaccttatgtattgggtaaagcagactccccttttgcccgcaaccagccgatgttc
gacacggtgataggttcacgcttccccaacccctggattgccaaagagtacggcagccac
agcatgccggaaaccgccgataacattgcccacgacctgaatattggccgcgatgccagc
gatgcgtttgccgcccgctcccaggcgcgctacgcccagtcactggcagccggcttctac
gacggcgaaatgttgggtgttgaggttcctcaagtgcgcaaacagccgcccctgctggta
gataaagacgagcatccacgtccgcaaagcacggaagataaattggccaagttagccgca
ctgtttgagggcggcgtggtgaccgcaggcaacgcctcaggccttaacgacggtgccgcc
gccctgattgtgggcacccaggctgccggtgagcgtgtaggcttaaccccacgcgcgcgc
attgtcgccagcgccgttgccggtgttgcgccgcgggtgatggggttagggccagtaccc
gcttcacaaaaagcgctggcgcgtgccgggcttacccttgagcagatggatgtgattgaa
attaacgaagcgtttgccgttcaggtgcttggctgcgtgcagcagttggggctctccgtc
gacgatccacgcttgaatgccaacggcggcgctatcgccattggccatcccctaggggct
tcaggagcacgcttggcgcttacggctctccgacagcttgaaacgaccggtgggcgctat
gcgttggttaccatgtgcatcggcgtcggtcagggcattgccacaattatcgagcgtctg
gacagctga

DBGET integrated database retrieval system