KEGG   Halobacterium sp. NRC-1: VNG0089GHelp
Entry
VNG0089G          CDS       T00038                                 

Gene name
pimT1
Definition
L-isoaspartyl protein carboxyl methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hal  Halobacterium sp. NRC-1
Brite
Enzymes [BR:hal01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     VNG0089G (pimT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(77923..78660)
Genome map
AA seq 245 aa AA seqDB search
MEFGALREEMVDSLLDAGTALADARPADAAMRAVPRHEFVDAGHRAYTDQAFEHRGTRVL
APSTVARLVGALEPRAGDDVLVVGAGVGYTVAVVAEIAGPTHVHAVDIDRQVVYDARGNL
ADAGYEDVLVDCRDGAEGLAEYAPFDRVLVEAGAASVPDALARQLAADGRLVFPEGVGDQ
RLVSVRDGETVGVHGPVSFAPLLVAGEQASAVERNRTVREDRERVREAAQSRPGWEREWI
DWEDA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggagtttggggcgttgcgcgaggagatggtcgacagcctcctcgacgcggggacggcg
ctcgcggacgcgcggccggcggacgcggcgatgcgtgcggttccccgccacgagttcgtc
gacgcggggcatcgggcgtacaccgatcaggcgttcgaacaccgcgggacgcgcgtgctc
gcgccgtcgacagtcgcgcggctggtgggagcgctggagccacgggctggcgacgacgtg
ctcgtggtcggggccggcgtcgggtatacggtggcggtggtggccgagatcgccggcccg
acacacgtgcacgccgtggacatcgaccggcaggtcgtgtacgacgcgcgcgggaacctc
gccgacgccgggtacgaggacgtgctcgtggactgccgggacggcgctgaggggctggcg
gagtacgcgccgttcgaccgcgtgctcgtggaggccggggcggccagcgtgccggacgcg
ctcgcccgccagctcgcggccgacgggcggctggtgttcccggagggcgtcggcgatcag
cgcctggtgtccgttcgggacggcgagacggtcggcgtgcatgggccggtgtcgttcgcg
ccgctgctggtggccggcgagcaggccagcgccgtcgagcgcaaccgcaccgtgcgcgag
gaccgcgagcgcgtgcgcgaggcggcgcagtcccgcccgggctgggagcgcgagtggatc
gactgggaggacgcgtag

DBGET integrated database retrieval system