KEGG   Halobacterium sp. NRC-1: VNG0307GHelp
Entry
VNG0307G          CDS       T00038                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hal01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hal00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:hal00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
241293..242585
Genome map
AA seq 430 aa AA seqDB search
MSTNTDDTTRTDGTFGDYGGQYVPEVLMPAVEELTDAYERYVLDNEDGFVDDFRQRIRSF
GGRPTPLTHAPTLSQRHGVDVYLKREDLLHGGAHKLNNALGQVLLAKYMGKDRIVAETGA
GQHGTATAMACAALEMPCEIYMGRTDVNRQRPNVFRMRLHDADVNPVTVGSGTLKEAINE
TMRDWATNVADTHYVIGSVVGPHPFPSMVRDFQAIISEELRAQSREQLGELPAAVIACAG
GGSNTMGAFGAFVGSASLPGAPAGTHEPAPDVDLLAVEAGGSRLGVDDDAGYAPNSASLS
TGTEGVLHGARTKLLQTETGQIVESHSVSAGLDYAGVGPELAHLVDTGRITPTNVDDDAA
LAAFHRLSRDEGVIPALETSHAVAALDQYDGDGPVVVNVSGRGDKDLDTVIEASAANDID
AAPDMEVFEQ
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgaacaccgacgacacgacacggacggacggaacgttcggggactacggcggc
cagtacgtccccgaggtactgatgcccgcagtcgaggaactgaccgacgcctacgagcgg
tacgtcctggacaacgaggacggcttcgtggacgacttccgccagcgaatccgctcgttc
ggcgggcggcccacgccgctgacccacgccccgacgctcagccagcgccacggcgtcgac
gtctacctcaaacgcgaggacctcctgcacggcggcgcgcacaaactcaacaacgccctg
gggcaggtgttgctcgccaaatacatgggcaaagaccgcatcgtcgcggagaccggggcc
ggccagcacggcaccgcaaccgcgatggcctgtgccgccctggagatgccatgcgagatc
tacatggggcgcaccgacgtgaaccgccagcgccccaacgtcttccggatgcggctgcac
gacgccgacgtgaacccggtgaccgtcggctcggggacgctgaaagaggccatcaacgag
acgatgcgtgactgggcgacgaacgtcgcggacacccactacgtcatcgggtcggtcgtc
ggcccacacccgttcccgtcgatggtgcgggacttccaggcgatcatcagcgaggagctg
cgcgcgcagtcccgcgagcagctcggcgaactcccggccgccgtcatcgcgtgcgccggc
ggcggctcgaacaccatgggtgcgttcggcgcgttcgtcgggagcgccagcctgccgggg
gctccggcgggcacacacgagccggcccccgacgtggacctgctggccgtcgaagccggc
ggctcgcgcctcggcgtcgacgacgacgcggggtacgcgccgaactccgccagcctctcg
acgggcaccgagggcgtcctgcacggcgcgcgcacgaaactccttcagacggagaccggc
cagatcgtggaatcacactccgtgtccgccggcctcgactacgcgggggtcggcccggag
ctggcacacctcgtcgacaccggccgcatcacacccaccaacgtcgacgacgacgccgcg
ctcgcggcgttccaccggctgtcgcgcgacgagggcgtgatccccgccctcgaaacgagc
cacgcggtcgccgccctcgaccagtacgacggcgacggtcccgtggtggtgaacgtctcc
ggccggggggacaaggatctggacaccgtcatcgaggcgtcggcggccaacgacatcgac
gccgcgccggacatggaggtgttcgagcagtga

DBGET integrated database retrieval system