KEGG   Halobacterium sp. NRC-1: VNG0412GHelp
Entry
VNG0412G          CDS       T00038                                 

Gene name
folP
Definition
hypothetical protein
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hal00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(319297..321744)
Genome map
AA seq 815 aa AA seqDB search
MRYDEAANFLLDLRRYGPKPGTESTADLLASLGDPHQDGPDYVQIAGSNGKGSTARFTES
ILRAAGLDVGLYTSPHFDDVRERVTVNGRRMSKAALTTFIETITPYVTERAADGAAPTYF
EVVTAMALWQFSRADVDVAVLEVGIGGRLDATSVVDPSASAVTSVTLEHTDVLGETIPEI
ARDKAHVAPAGDTPLVTATTDDALAAVRDHAGAVRTVGDTAGRDVTATYEGRTNHTEAAV
SITGDDWSVATEIPLLGDHQAENAGVAAALARQTAGVDDDAIARGLRSAHWPGRFEVMGA
DPVVVLDGAHNPGACGAVAETVAEFDYDRLLTVFGAMHDKDHGAMAAALPTPDHVWACEP
VPDRAEDADVLAAVFEDAGAGTVSVTRAVESAVADAIAEATADDLVLVAGSLFAVAEART
RWTRTFAETDVDSLDDARDALERAHVTPPGVWRMRGKGVHRVVKTRVQTRQAQYLKEELL
SLGGECSVSGLNAQSGAMVDAVMMATMAQFKRLCEKLDGQPYGLSEVGADLRESLGIQAA
PATHGYPWEGERTAVMGILNVTPDSFHDGGEYDALEDAVARAESMAENGVDVIDIGGEST
RPGADAVSVADELDRVLPVIERISDLDVLLSVDTRKAEVARQALEAGADILNDVTGLDDP
EMRFVAAEYDAPIVVMHSIDAPVDPDSDPDYDDVVDDVIAELTERVLLAEKAGVPRERII
VDPGLGFGKSAAEGFELLDRADEFHALGGPVLVGHSHKSMFGAVDRYPDEGGYATAAASA
LAADRGADIVRVHDVPENVAAVRVAEATRTGADAE
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacgacgaagcggcgaacttcctgctggacctccggcggtacgggccgaaaccg
gggaccgagtcgacggcggacctgcttgccagcctcggcgacccacaccaggacggcccc
gactacgtgcagatcgcggggtccaacgggaagggatcgaccgcacggttcacggagtcc
atcctccgggcggccggcctggacgtggggctgtacacgtcgccgcatttcgacgacgtg
cgcgagcgggtgaccgtcaacggccgccgcatgtcgaaggcggcgctgacgacgttcatc
gagacgatcacgccgtacgtgaccgagcgcgcggccgacggggccgcgccgacgtacttc
gaggtcgtgaccgcgatggcgctgtggcagttcagccgcgcggacgtggacgtggcggtg
cttgaggtcgggatcggcggccgcctggacgcgaccagtgtggtggacccgtcggcgagc
gccgtcacgtcggtgaccctcgaacacaccgacgtgctcggggagacgatccccgagatc
gcgcgggacaaagcccacgtcgcgccggcgggcgatacgccgctggtgaccgcgaccacc
gacgatgcgctggcggccgtgcgcgaccacgcgggtgccgtccgcactgtcggcgacacc
gcggggcgcgacgtgaccgcgacctacgaggggcgcaccaaccacaccgaggccgcggtc
tcgatcaccggcgacgactggtcggtggccaccgagatcccgctgctgggcgaccaccag
gccgagaacgcgggcgtcgcggcggcgctggcgcgacagacggcgggcgtcgacgacgac
gccatcgcgcgcgggctgcggagcgcgcactggccggggcgcttcgaggtgatgggggcc
gaccccgtggtggtgttggacggcgcgcacaacccgggggcgtgtggtgccgtcgcggag
acggtcgccgagttcgactacgaccgcctgctgaccgtgttcggcgcgatgcacgacaag
gatcacggggcgatggcggccgcgctcccgacgcccgaccacgtgtgggcgtgcgagccg
gtgcccgaccgtgcggaggacgccgacgtgctcgcggcggtgttcgaggacgccggcgcg
ggaaccgtgagcgtgacgcgggccgtggagtcggcggtcgcggacgcgatcgcggaggcg
accgcggacgacctcgtgctcgtcgcgggatcgctgttcgcggtcgcggaagcccggacc
cggtggacgcgcacgttcgcggagaccgacgtcgacagcctcgacgacgcgcgggacgcg
cttgagcgcgcgcacgtgacgccgccgggggtgtggcggatgcgcgggaagggcgtccac
cgcgtggtgaaaaccagggtgcagacgcggcaggcccagtacctcaaagaggagctgttg
agcctcggcggggagtgttcggtgtcggggctgaacgcgcagtccggggcgatggttgac
gccgtcatgatggcgacgatggcgcagttcaagcgcctctgtgagaaactcgacgggcag
ccctacggcctcagcgaggtcggcgcggacctccgggagtcgctgggcatccaggcggca
ccggccacgcatggctacccctgggagggcgagcgcaccgccgtgatgggcatcctgaac
gtcacgccggacagcttccacgacggcggcgagtacgacgccctcgaagacgcggtcgcg
cgcgccgagtcgatggccgaaaacggcgtcgacgtcatcgacatcggcggggagtccacg
cgccccggtgccgacgccgtcagcgtcgccgacgaactcgatcgggtgctcccggtgatc
gagcggatcagcgacctggacgtgttgctgtcggtggacacccggaaagccgaggtcgcg
cggcaggccctggaggcgggggcggacatcctcaacgacgtgaccgggttggacgacccc
gagatgcggttcgtggccgccgagtacgacgccccgatcgtcgtgatgcattcgatcgac
gcgccggtcgaccccgacagcgatcccgactacgacgacgtggtcgacgacgtcatcgcg
gagctcaccgagcgcgtgctgctcgccgagaaggccggcgtcccccgcgagcggatcatc
gtcgaccccgggctcgggttcggcaaaagcgccgccgagggcttcgagttgctggaccgc
gccgacgagttccacgcgctcggcggccccgtgctggtcgggcacagccacaagtcgatg
ttcggcgcggtcgaccgctacccggacgaaggcgggtacgcgaccgcggccgcgtcggcg
ctggcggccgaccgcggcgcggacatcgtgcgcgtccacgacgtgcccgagaacgtcgcc
gccgtccgggtcgccgaggcaacccggaccggtgcggacgcggagtga

DBGET integrated database retrieval system