KEGG   Halobacterium sp. NRC-1: VNG0484GHelp
Entry
VNG0484G          CDS       T00038                                 

Gene name
acs1
Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VNG0484G (acs1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VNG0484G (acs1)
   00620 Pyruvate metabolism
    VNG0484G (acs1)
   00640 Propanoate metabolism
    VNG0484G (acs1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    VNG0484G (acs1)
   00680 Methane metabolism
    VNG0484G (acs1)
Enzymes [BR:hal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     VNG0484G (acs1)
Lipid biosynthesis proteins [BR:hal01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   VNG0484G (acs1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
374853..376823
Genome map
AA seq 656 aa AA seqDB search
MDSLDGVGTVVHEPDPALASSTNVAQFMTAHDIDDVDALRERSTTDLDWFWGELPEYLGL
EFFEDYDAVRDDADDPQSTAWYPGAELNVAHNTVDRHASVDAGTRNHVACIWEGEDGTVR
QQTYHDLHQQANRVANALAERGIGEGDTVGLYMPMVPEVQSILYGIFKIGAIAVPIFSGF
GVEATATRIADAECSVVFTGDGFLRRGDRVTLMDTLNDAIERAGHVDHTIVYDRLGIPAD
SLSWTPRDEWWDDAVATQSPTFETHSMAASDPCMLLYSSGTTGTPKGIVHTHAGALVQPA
KEIHFGFDQRPGDRFCWVSDIGWMMGPWSLIGNHAFAGTIVMYEGAPDHPAPDRFWQLIE
DHGITQFGVSPTAIRALRDHGDEHVAGHDLSSLRILGSTGEPWDPESWRWFYDHVGGGDT
PIINISGGTEVFGCFLMPLPTESLKPCTLGGPGLGMDIDIVDDDGTSVRDANERGYLVAR
SSSPSMTRRLWSGEDRYLEAYWSRFEDVWNHGDWAQMDADGDWFLHGRADDAINVAGRKV
GPAEVEGALIDHDAVTQAAVVGVPDDTTGEAAIAYVILADAATPSAELRAELRDHVGDAH
GKPFRPREVVFVDDLPKTQSGKLVRRAVASAYTGADVTDRSSIENPAVLDALRDAT
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggattcactcgacggagtcggcacggtcgtccacgaaccggaccctgcgctcgcgtcg
tcgacgaacgtcgcccagttcatgaccgcccacgacatcgacgacgtggacgcgctccgc
gagcgcagcaccactgatctcgactggttctggggggaactcccggagtatctcggcctg
gagttcttcgaagactacgacgccgtccgcgacgacgccgacgacccccagtccacggcg
tggtatccgggcgccgaactgaacgtcgcgcacaacaccgtcgaccgccacgccagcgtc
gacgccggcacccgcaaccacgtcgcctgcatctgggagggcgaggacggcacggtccgc
caacagacctaccacgacctccaccagcaggccaaccgggtggccaacgcccttgctgag
cgcggcatcggcgagggcgacacggtgggcctctacatgccgatggtcccggaagtccag
agcatcctctacggcatcttcaagatcggcgcgatcgccgtccccatcttctccgggttc
ggcgtcgaggccaccgccacgcgcatcgccgacgccgagtgttcggtggtgttcacgggc
gacggcttcctgcggcggggcgaccgcgtcacgctcatggacaccctcaacgacgccatc
gagcgggccggccacgtcgaccacaccatcgtctacgaccgcctcggcatccccgcggac
tcgctgtcctggacgccccgcgacgagtggtgggacgacgccgtggccacccagtccccg
acgttcgagacgcactcgatggccgccagcgatccgtgcatgctgttgtactcctcgggg
acgacgggaacaccgaaaggcatcgtccacacccacgccggcgcgctcgtccaacccgcc
aaggagatccacttcgggttcgaccagcggcccggcgaccggttctgctgggtgagcgac
atcggctggatgatggggccgtggtcgctcatcgggaaccacgcgttcgccggcaccatc
gtgatgtacgagggcgcccccgaccaccccgcccccgaccgcttctggcagctcatcgag
gaccacggcatcacccagttcggcgtctccccgacggcgatccgtgcactgcgcgaccac
ggcgacgagcacgtcgccggccacgatctctcctcgctgcgcatcctggggtcgacgggc
gagccctgggaccccgagtcctggcggtggttttacgaccacgtcggcggcggtgacacc
ccgatcatcaacatctccggcggcacggaagtgttcggctgcttcctcatgccgctgccg
acggagtcgctgaaaccctgcacgctcggcggccccgggctcggcatggacatcgacatc
gtcgacgacgacggcacctccgttcgggacgccaacgagcgcggctacctcgtcgcgcgg
tcgtccagcccgtcgatgacgcggcgcctctggagcggcgaggaccgctacctggaggcg
tactggtcgcgcttcgaggacgtctggaaccacggcgactgggcgcagatggacgccgac
ggcgactggttcctccacgggcgcgccgacgacgccatcaacgtcgccggccgcaaagtc
ggcccggcggaggtcgagggcgcgctcatcgaccacgacgccgtcacacaggcggccgtc
gtcggagtgcccgacgacaccaccggtgaggccgccatcgcgtacgtcatcctcgccgac
gccgccaccccgagcgcggagctgcgcgcggaactgcgcgaccacgtcggcgacgcccac
ggcaaaccgttccggccccgggaggtggtgttcgtcgacgacctgccgaaaacccagtcc
gggaagctcgtgcgccgcgccgtcgccagcgcgtacaccggggcggacgtcacggaccgc
tccagcatcgagaaccctgcggtgctggacgcgctccgggacgcgacctag

DBGET integrated database retrieval system