KEGG   Halobacterium sp. NRC-1: VNG0484GHelp
Entry
VNG0484G          CDS       T00038                                 

Gene name
acs1
Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:hal01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hal00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hal00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hal00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:hal00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
374853..376823
Genome map
AA seq 656 aa AA seqDB search
MDSLDGVGTVVHEPDPALASSTNVAQFMTAHDIDDVDALRERSTTDLDWFWGELPEYLGL
EFFEDYDAVRDDADDPQSTAWYPGAELNVAHNTVDRHASVDAGTRNHVACIWEGEDGTVR
QQTYHDLHQQANRVANALAERGIGEGDTVGLYMPMVPEVQSILYGIFKIGAIAVPIFSGF
GVEATATRIADAECSVVFTGDGFLRRGDRVTLMDTLNDAIERAGHVDHTIVYDRLGIPAD
SLSWTPRDEWWDDAVATQSPTFETHSMAASDPCMLLYSSGTTGTPKGIVHTHAGALVQPA
KEIHFGFDQRPGDRFCWVSDIGWMMGPWSLIGNHAFAGTIVMYEGAPDHPAPDRFWQLIE
DHGITQFGVSPTAIRALRDHGDEHVAGHDLSSLRILGSTGEPWDPESWRWFYDHVGGGDT
PIINISGGTEVFGCFLMPLPTESLKPCTLGGPGLGMDIDIVDDDGTSVRDANERGYLVAR
SSSPSMTRRLWSGEDRYLEAYWSRFEDVWNHGDWAQMDADGDWFLHGRADDAINVAGRKV
GPAEVEGALIDHDAVTQAAVVGVPDDTTGEAAIAYVILADAATPSAELRAELRDHVGDAH
GKPFRPREVVFVDDLPKTQSGKLVRRAVASAYTGADVTDRSSIENPAVLDALRDAT
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggattcactcgacggagtcggcacggtcgtccacgaaccggaccctgcgctcgcgtcg
tcgacgaacgtcgcccagttcatgaccgcccacgacatcgacgacgtggacgcgctccgc
gagcgcagcaccactgatctcgactggttctggggggaactcccggagtatctcggcctg
gagttcttcgaagactacgacgccgtccgcgacgacgccgacgacccccagtccacggcg
tggtatccgggcgccgaactgaacgtcgcgcacaacaccgtcgaccgccacgccagcgtc
gacgccggcacccgcaaccacgtcgcctgcatctgggagggcgaggacggcacggtccgc
caacagacctaccacgacctccaccagcaggccaaccgggtggccaacgcccttgctgag
cgcggcatcggcgagggcgacacggtgggcctctacatgccgatggtcccggaagtccag
agcatcctctacggcatcttcaagatcggcgcgatcgccgtccccatcttctccgggttc
ggcgtcgaggccaccgccacgcgcatcgccgacgccgagtgttcggtggtgttcacgggc
gacggcttcctgcggcggggcgaccgcgtcacgctcatggacaccctcaacgacgccatc
gagcgggccggccacgtcgaccacaccatcgtctacgaccgcctcggcatccccgcggac
tcgctgtcctggacgccccgcgacgagtggtgggacgacgccgtggccacccagtccccg
acgttcgagacgcactcgatggccgccagcgatccgtgcatgctgttgtactcctcgggg
acgacgggaacaccgaaaggcatcgtccacacccacgccggcgcgctcgtccaacccgcc
aaggagatccacttcgggttcgaccagcggcccggcgaccggttctgctgggtgagcgac
atcggctggatgatggggccgtggtcgctcatcgggaaccacgcgttcgccggcaccatc
gtgatgtacgagggcgcccccgaccaccccgcccccgaccgcttctggcagctcatcgag
gaccacggcatcacccagttcggcgtctccccgacggcgatccgtgcactgcgcgaccac
ggcgacgagcacgtcgccggccacgatctctcctcgctgcgcatcctggggtcgacgggc
gagccctgggaccccgagtcctggcggtggttttacgaccacgtcggcggcggtgacacc
ccgatcatcaacatctccggcggcacggaagtgttcggctgcttcctcatgccgctgccg
acggagtcgctgaaaccctgcacgctcggcggccccgggctcggcatggacatcgacatc
gtcgacgacgacggcacctccgttcgggacgccaacgagcgcggctacctcgtcgcgcgg
tcgtccagcccgtcgatgacgcggcgcctctggagcggcgaggaccgctacctggaggcg
tactggtcgcgcttcgaggacgtctggaaccacggcgactgggcgcagatggacgccgac
ggcgactggttcctccacgggcgcgccgacgacgccatcaacgtcgccggccgcaaagtc
ggcccggcggaggtcgagggcgcgctcatcgaccacgacgccgtcacacaggcggccgtc
gtcggagtgcccgacgacaccaccggtgaggccgccatcgcgtacgtcatcctcgccgac
gccgccaccccgagcgcggagctgcgcgcggaactgcgcgaccacgtcggcgacgcccac
ggcaaaccgttccggccccgggaggtggtgttcgtcgacgacctgccgaaaacccagtcc
gggaagctcgtgcgccgcgccgtcgccagcgcgtacaccggggcggacgtcacggaccgc
tccagcatcgagaaccctgcggtgctggacgcgctccgggacgcgacctag

DBGET integrated database retrieval system