KEGG   Halobacterium sp. NRC-1: VNG0484GHelp
Entry
VNG0484G          CDS       T00038                                 

Gene name
acs1
Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VNG0484G (acs1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VNG0484G (acs1)
   00620 Pyruvate metabolism
    VNG0484G (acs1)
   00640 Propanoate metabolism
    VNG0484G (acs1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    VNG0484G (acs1)
   00680 Methane metabolism
    VNG0484G (acs1)
Enzymes [BR:hal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     VNG0484G (acs1)
Lipid biosynthesis proteins [BR:hal01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   VNG0484G (acs1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
374853..376823
Genome map
AA seq 656 aa AA seqDB search
MDSLDGVGTVVHEPDPALASSTNVAQFMTAHDIDDVDALRERSTTDLDWFWGELPEYLGL
EFFEDYDAVRDDADDPQSTAWYPGAELNVAHNTVDRHASVDAGTRNHVACIWEGEDGTVR
QQTYHDLHQQANRVANALAERGIGEGDTVGLYMPMVPEVQSILYGIFKIGAIAVPIFSGF
GVEATATRIADAECSVVFTGDGFLRRGDRVTLMDTLNDAIERAGHVDHTIVYDRLGIPAD
SLSWTPRDEWWDDAVATQSPTFETHSMAASDPCMLLYSSGTTGTPKGIVHTHAGALVQPA
KEIHFGFDQRPGDRFCWVSDIGWMMGPWSLIGNHAFAGTIVMYEGAPDHPAPDRFWQLIE
DHGITQFGVSPTAIRALRDHGDEHVAGHDLSSLRILGSTGEPWDPESWRWFYDHVGGGDT
PIINISGGTEVFGCFLMPLPTESLKPCTLGGPGLGMDIDIVDDDGTSVRDANERGYLVAR
SSSPSMTRRLWSGEDRYLEAYWSRFEDVWNHGDWAQMDADGDWFLHGRADDAINVAGRKV
GPAEVEGALIDHDAVTQAAVVGVPDDTTGEAAIAYVILADAATPSAELRAELRDHVGDAH
GKPFRPREVVFVDDLPKTQSGKLVRRAVASAYTGADVTDRSSIENPAVLDALRDAT
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggattcactcgacggagtcggcacggtcgtccacgaaccggaccctgcgctcgcgtcg
tcgacgaacgtcgcccagttcatgaccgcccacgacatcgacgacgtggacgcgctccgc
gagcgcagcaccactgatctcgactggttctggggggaactcccggagtatctcggcctg
gagttcttcgaagactacgacgccgtccgcgacgacgccgacgacccccagtccacggcg
tggtatccgggcgccgaactgaacgtcgcgcacaacaccgtcgaccgccacgccagcgtc
gacgccggcacccgcaaccacgtcgcctgcatctgggagggcgaggacggcacggtccgc
caacagacctaccacgacctccaccagcaggccaaccgggtggccaacgcccttgctgag
cgcggcatcggcgagggcgacacggtgggcctctacatgccgatggtcccggaagtccag
agcatcctctacggcatcttcaagatcggcgcgatcgccgtccccatcttctccgggttc
ggcgtcgaggccaccgccacgcgcatcgccgacgccgagtgttcggtggtgttcacgggc
gacggcttcctgcggcggggcgaccgcgtcacgctcatggacaccctcaacgacgccatc
gagcgggccggccacgtcgaccacaccatcgtctacgaccgcctcggcatccccgcggac
tcgctgtcctggacgccccgcgacgagtggtgggacgacgccgtggccacccagtccccg
acgttcgagacgcactcgatggccgccagcgatccgtgcatgctgttgtactcctcgggg
acgacgggaacaccgaaaggcatcgtccacacccacgccggcgcgctcgtccaacccgcc
aaggagatccacttcgggttcgaccagcggcccggcgaccggttctgctgggtgagcgac
atcggctggatgatggggccgtggtcgctcatcgggaaccacgcgttcgccggcaccatc
gtgatgtacgagggcgcccccgaccaccccgcccccgaccgcttctggcagctcatcgag
gaccacggcatcacccagttcggcgtctccccgacggcgatccgtgcactgcgcgaccac
ggcgacgagcacgtcgccggccacgatctctcctcgctgcgcatcctggggtcgacgggc
gagccctgggaccccgagtcctggcggtggttttacgaccacgtcggcggcggtgacacc
ccgatcatcaacatctccggcggcacggaagtgttcggctgcttcctcatgccgctgccg
acggagtcgctgaaaccctgcacgctcggcggccccgggctcggcatggacatcgacatc
gtcgacgacgacggcacctccgttcgggacgccaacgagcgcggctacctcgtcgcgcgg
tcgtccagcccgtcgatgacgcggcgcctctggagcggcgaggaccgctacctggaggcg
tactggtcgcgcttcgaggacgtctggaaccacggcgactgggcgcagatggacgccgac
ggcgactggttcctccacgggcgcgccgacgacgccatcaacgtcgccggccgcaaagtc
ggcccggcggaggtcgagggcgcgctcatcgaccacgacgccgtcacacaggcggccgtc
gtcggagtgcccgacgacaccaccggtgaggccgccatcgcgtacgtcatcctcgccgac
gccgccaccccgagcgcggagctgcgcgcggaactgcgcgaccacgtcggcgacgcccac
ggcaaaccgttccggccccgggaggtggtgttcgtcgacgacctgccgaaaacccagtcc
gggaagctcgtgcgccgcgccgtcgccagcgcgtacaccggggcggacgtcacggaccgc
tccagcatcgagaaccctgcggtgctggacgcgctccgggacgcgacctag

DBGET integrated database retrieval system