KEGG   Halobacterium sp. NRC-1: VNG0541GHelp
Entry
VNG0541G          CDS       T00038                                 

Gene name
thrC2
Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VNG0541G (thrC2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VNG0541G (thrC2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    VNG0541G (thrC2)
Enzymes [BR:hal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     VNG0541G (thrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(417903..419099)
Genome map
AA seq 398 aa AA seqDB search
METTRAFEGLECVDCGESFAAAAATHRCPECGGILDPAYDLENLDVDAETFGARRFDSLW
RYAELLPFTRGSAVSMDEGATALVPCPGLADELGVGELYIKDEGRNPTGTFRDRGQTVAM
TAAAQHGASEVALASTGNAGQSAGAYAGRAGLDAHVFLPSRSGFTTKAMVNVHGGDMNVV
QGRIGDANAAFEDAMDEHGEAWYSLQAFATPYRHEGKKTLLYETVEQLDWETPDHVVYPT
GDGGGLVGMWKAATELRELGITADVPAMYAAQAEGCAPIVRAFQEGRDAHEPWDTPDTIC
GGIEIPDPAGSRLVLEALRESNGGAVAASDEEILEAGTAVASRAGPEMGATCAAAAAGAW
ELADRDAFGEDDTVVVVSTGTANKAADVLRSHLMSKGI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggagacgacgcgagccttcgaggggctggagtgcgtggactgtggggaatcgttcgcg
gccgcggcggcgacccaccggtgtccggagtgtgggggcatcctcgaccccgcctacgac
ctggagaacctggacgtggacgccgagacgttcggcgcgcggcggttcgactcgctgtgg
cggtacgcggagttgctgccgttcacgcgtgggtcggcggtgtcgatggacgagggggcg
acggcgctggttccgtgtccggggctggccgacgaactcggcgtgggcgaactctacatc
aaagacgaggggcgcaacccgaccggcacgttcagggaccgcgggcagacggtggcgatg
acggcggcggcccagcacggtgccagcgaggtggcgttggcgtcgacggggaacgccgga
cagtcagcgggagcgtacgccggtcgtgcgggcctcgatgcacacgtgttcctgccgtcc
cgctcggggttcacaaccaaggcgatggtgaacgtccacggcggcgacatgaacgtcgtg
caggggcgcatcggcgacgccaacgccgcctttgaggacgccatggacgaacacggcgag
gcgtggtactcgctgcaggcgttcgcgacgccgtaccgccacgagggcaaaaagacgctg
ctgtacgagaccgtcgagcaactcgactgggagacgcccgaccacgtggtctatccgacc
ggcgacggcggcgggctcgtggggatgtggaaggccgccacggagctccgcgagctcggc
atcaccgcggacgtgccggcgatgtacgccgcacaggccgaggggtgtgcgccgatcgtg
cgggcgttccaggagggccgcgacgcccacgagccgtgggacacgccggacaccatctgt
ggcggcatcgagatcccggaccccgcgggcagccggctggtgttggaggcactgcgcgag
agcaacggcggcgcggtggccgcgagcgacgaggagatcctggaggcgggcaccgcggtc
gccagccgtgcgggcccggagatgggggcgacgtgcgcggcggcggcggcgggcgcgtgg
gagctggctgaccgggacgcgttcggggaagacgacaccgtggtggtggtgagcacgggg
acggcgaacaaggcggcggacgtgttgcggtcgcatctgatgagcaaaggcatctga

DBGET integrated database retrieval system