KEGG   Halobacterium sp. NRC-1: VNG0867GHelp
Entry
VNG0867G          CDS       T00038                                 

Gene name
asnA
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VNG0867G (asnA)
Enzymes [BR:hal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     VNG0867G (asnA)
Peptidases [BR:hal01002]
 Cysteine Peptidases
  Family C44
   VNG0867G (asnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
654935..656017
Genome map
AA seq 360 aa AA seqDB search
MRGAAPDAVLDAVQSGDPLPGTGGFAGELPDGRLARDVLGRRLCYVDGDEWSHDPRDLAA
PTLLPAGHVRAPGATGSGRPVWSLPEPAPTGDEPVERVRDAVAGALGGVPAGDDLAVAFS
GGVDSALAAAALDAPLYVVGYADSSDIAAARESAAAMGRADDLRVHEVTLADIEAAVPTV
ARAIGRTNAMAVQIALPLFLVAARAAADGYSRLVVGQGADELFGGYAKVAKAPTDPRTDA
DTVRGARRETVQSLPAQLERDLRALRAAGVEPVTPLLHDDVVRAALALPGEWLVSGDTRK
RALREAARSWLPDAVADRDKKAVQYGSLVAREVDRLARQAGFKRRMDDHVTQYVEARIEE
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcggggcgctgcccccgacgcagtgctggacgccgtccagtcgggcgacccgctgccc
ggaaccggcgggttcgcgggcgagctgccggacggccggctcgcacgggacgtgttgggc
cgccggctgtgttacgtcgacggcgacgagtggagccacgacccacgggatctcgctgcg
ccgacgctcctgccggccggccacgttcgcgctccgggcgcgaccggcagcggacggccg
gtgtggtcgctcccggagccggcgccgaccggcgacgagccggtcgagcgcgtccgggac
gccgttgcgggcgcgctcgggggcgttcctgcgggcgacgacctggcggtggcgttctcc
ggcggcgtcgactccgcgctcgccgcggccgcgctggacgcgccgctgtacgtcgtcggc
tacgcggacagcagcgacatcgcggcggcccgcgagtcggcggccgccatggggcgtgcc
gacgacctgcgcgtgcacgaagtgacgctggcggacatcgaggcggccgtgccgacggtg
gcgcgggcgatcggccgcacgaacgccatggccgtccagatcgcgttgccgttgttcctg
gtcgccgcccgggcggccgccgacggctacagccgcctcgtggtcgggcagggggccgac
gagctgttcggtgggtacgcgaaggtcgcgaaagcgccgaccgacccgcgcaccgacgcc
gacactgtgcgcggtgcgcgccgggagacggtgcagtcgctgccggcccaactggagcgg
gatctgcgcgcgctgcgggcggccggcgtggagccggtgacgccgctgctgcacgacgac
gtggtgcgcgcggcgctcgcgctgccgggggagtggctcgtgtcgggcgacacccggaaa
cgcgcgctccgggaggcggcccgatcgtggctgcccgacgcggtagccgaccgcgacaag
aaagccgtgcagtacggcagcctggtcgcccgcgaggtcgaccggctcgcccgccaggcg
gggttcaagcgccgcatggacgaccacgtcacacagtacgtcgaggcccgcatcgaggag
tga

DBGET integrated database retrieval system