KEGG   Halobacterium sp. NRC-1: VNG1027GHelp
Entry
VNG1027G          CDS       T00038                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VNG1027G (tpiA)
   01230 Biosynthesis of amino acids
    VNG1027G (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VNG1027G (tpiA)
   00051 Fructose and mannose metabolism
    VNG1027G (tpiA)
   00562 Inositol phosphate metabolism
    VNG1027G (tpiA)
Enzymes [BR:hal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VNG1027G (tpiA)
Exosome [BR:hal04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VNG1027G (tpiA)
  Exosomal proteins of bladder cancer cells
   VNG1027G (tpiA)
  Exosomal proteins of melanoma cells
   VNG1027G (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(786530..787174)
Genome map
AA seq 214 aa AA seqDB search
MFVLVNLKAYPCDPVAIAEAAADVAETTPATIAVAPQPADIGRVADTGATTYAQHVSPTE
HGSHTGSVLAESVADNGAVGTLLNHSEHRRRLADIDGSVAAAERAGLDTVVCANNPAQVA
AAAALGPDAVAVEPPALIGTGTPVSQADPDIVSDAVAAAEAVDPSVDVYCGAGITTGEDV
VSAGDLGASGVLLASGVAKADDPRAALADLVAPL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttctcgtcaacctcaaggcgtacccctgtgatccggtcgccatcgcggaggcg
gctgccgacgtcgctgagacgaccccagccacgatcgcggtcgcaccccagcccgcggac
atcggtcgcgtcgcggacacgggtgccaccacgtacgcccaacacgtcagcccgaccgag
cacggcagccacaccggcagcgtgctcgcggagtcggtcgcggacaacggcgctgtgggc
acgctgctgaaccactccgagcaccgccgccggctcgccgacatcgacggcagcgtcgcg
gccgccgagcgcgccggcctcgacacggtggtgtgcgcgaacaaccccgcacaggtcgcc
gccgccgccgcgctcggccccgacgcggtggccgtcgagccgccggcgctgatcggcacc
ggcacgccggtctcgcaggccgatccggacatcgtctccgacgccgtcgccgcggcggaa
gcggtcgatccgagcgtggacgtctactgcggcgcgggcatcaccaccggcgaggacgtc
gtgtcggccggcgacctcggcgccagcggcgtcctgctcgccagcggggtggcgaaggcc
gacgacccgcgcgcggcgctggcggacctcgtcgcgccgctgtag

DBGET integrated database retrieval system