KEGG   Halobacterium sp. NRC-1: VNG1201GHelp
Entry
VNG1201G          CDS       T00038                                 

Gene name
fucA
Definition
fuculose-1-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    VNG1201G (fucA)
Enzymes [BR:hal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     VNG1201G (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(902438..903073)
Genome map
AA seq 211 aa AA seqDB search
MLARERVDVVDYAPALSDLTPGRTGNLSVRDGDRFAATPTGVPYDGFDASDVPVVTLDGD
VVAGEMTPTSEVPMHTGIYQRLDAGAIVHTHSPWASTLAVLGDELPPIHYMITAVGRRVP
VAEYAPYGSDDLAELVVTEMADADSDACILAHHGLVVVGDDLADAVENTIHVEELCKVYL
RARRHGDPDTLTDDQLAAVERRFQSYGQGGD
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgtgaacgcgtcgacgtggtggactacgcaccggcactgagtgacctcacg
cccggccgcaccgggaacctgagcgttcgcgacggcgaccggttcgccgcgacgccgacc
ggcgtcccctacgacggcttcgacgccagcgacgtgcccgtggtcaccctcgacggtgac
gtggtcgccggcgagatgacgcccaccagcgaggtcccgatgcacacgggcatctaccag
cgccttgacgcgggcgcgatcgtgcacacgcactcgccgtgggcgtccacactggcggtg
ctgggcgacgaactccccccgatccactacatgatcacggcggtcgggcggcgcgtcccg
gtcgcggagtacgcgccctacggctccgacgatctggccgaactcgtcgtcacggagatg
gccgacgcggacagcgacgcctgcatcctcgcccaccacggtctcgtcgtcgtcggcgac
gacctggccgacgccgtcgagaacaccatccacgtcgaggagctgtgcaaggtgtatctg
cgggcgcgccgccacggcgacccggacacgctcaccgacgaccaactggccgccgtcgag
cgccggttccagtcctacgggcagggcggcgactga

DBGET integrated database retrieval system