KEGG   Halobacterium sp. NRC-1: VNG1297CHelp
Entry
VNG1297C          CDS       T00038                                 

Definition
S-adenosylmethionine synthetase (EC:2.5.1.6)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VNG1297C
   01230 Biosynthesis of amino acids
    VNG1297C
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VNG1297C
Enzymes [BR:hal01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     VNG1297C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
968577..969803
Genome map
AA seq 408 aa AA seqDB search
MTDRNIQVQSLDRSAVEDDAVEIVERKGLGHPDSICDGIAEHVCETLAREYRDRVGHVLH
FNTDETQLVAGDAAPAFGGGNVIDPIYILVVGRATSHYVEADGTEHHIPVESIALEAARE
YLRETLPHLDLETDVIVDVKLGEGSGDLQDVFTDDDDGPAVPMANDTSFGVGHAPLTETE
RIVLEAERSLNGPYAEHTPAVGEDVKVMGKREDDHIDLTIAAALVDAHVPDMDAYIAQVE
AIREHVFDLATEHTDREVTVHVNTADDYESGSIYLTTTGTSAEQGDDGSVGRGNRANGLI
TPNRAMSMEATSGKNPVNHIGKIYNLLSTQIAEAVVAEVDGIRDLRVRLLSQIGRPIDEP
HVADVEVVTEDGTAVADVDAEIERIVDAQLASVTDLTRRVIDGERTTF
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgactgaccggaacatccaagtacagtctctcgaccgcagcgcagtcgaggacgacgcc
gtcgaaatcgtcgagcgaaaggggctcggtcaccccgactccatctgcgacggcatcgcc
gaacacgtctgtgaaaccctcgcccgggaataccgcgaccgggtgggccacgtcctccac
ttcaacaccgacgagacccaactcgtcgccggtgacgccgcccccgcgttcggcggcggg
aacgtcatcgacccgatctacatcctggtcgtcggtcgcgccaccagccactacgtcgaa
gccgacggcaccgaacaccacatcccggtcgaatccatcgccctggaagccgcccgcgag
tacctgcgtgagacgctgccccacctggacctcgaaaccgacgtgatcgtcgacgtcaag
ctcggcgagggatcgggggacctccaggacgtgttcaccgacgacgacgacggccccgcc
gtgccgatggccaacgacacgtcgttcggcgtcggccacgccccgctcaccgaaaccgag
cgcatcgtcctcgaagccgagcgctcgctgaacggcccgtacgccgagcacacgcccgcg
gtcggcgaggacgtgaaagtgatggggaaacgcgaagacgaccacatcgacctcacgatc
gccgccgcgctcgtggacgcccacgtgccggacatggacgcctacatcgcccaggtcgaa
gccatccgcgagcacgtcttcgatctcgccaccgagcacacggaccgcgaggtcaccgtc
cacgtcaacaccgccgacgactacgagtcgggctcgatctacctcaccaccaccggcacc
agcgccgagcagggcgacgacggcagcgtcggccgcggcaaccgcgccaacggcctcatc
acccccaaccgcgccatgagcatggaagccacgtccggcaagaacccggtcaaccacatc
gggaagatctacaacctgctttcgacgcagatcgccgaggcggtcgtcgccgaggtcgac
ggcatccgcgacctccgggtgcgactgctctcacagatcggccgcccgatcgacgagccc
cacgtcgcggacgtggaagtcgtcaccgaggacggcaccgcggtggccgacgtcgacgcc
gagatcgagcgcatcgtcgacgcgcaactcgcgtcggtcacggacctcacgcgccgcgtc
atcgacggcgaacgcaccacgttctga

DBGET integrated database retrieval system