KEGG   Halobacterium sp. NRC-1: VNG1309GHelp
Entry
VNG1309G          CDS       T00038                                 

Gene name
sdhD
Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
hal  Halobacterium sp. NRC-1
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VNG1309G (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VNG1309G (sdhD)
   00650 Butanoate metabolism
    VNG1309G (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    VNG1309G (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(979298..979660)
Genome map
AA seq 120 aa AA seqDB search
MAKRYSSFRSGSTTWLLQRLTAGFLVVVLAFHFFNLHFVNHAYNIDFAGSQVRMQSLGYY
VTMVLFLVTATFHGVNGVYNALVNQGIEGNAKRAAQLVLGVAGVLLIVQGIRVANALAGF
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacgatactcctcgttccgatcgggatcgacgacgtggctgctccagcggctg
accgctgggttcctcgtcgtggtgttggcgttccacttcttcaacctgcacttcgtcaat
cacgcctacaacatcgacttcgccggcagccaggtccggatgcagagcctcggctactac
gtcacgatggtgttgttcctcgtgacggcgacgttccacggggtcaacggcgtctacaac
gccctcgtgaaccagggcatcgaggggaacgccaagcgcgccgcgcaactcgtgcttggg
gttgccggcgtgctgttgatcgtgcaggggattcgcgtggcgaacgcgcttgcggggttc
tag

DBGET integrated database retrieval system