KEGG   Halobacterium sp. NRC-1: VNG1344GHelp
Entry
VNG1344G          CDS       T00038                                 

Gene name
dchpS
Definition
DchpS
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VNG1344G (dchpS)
Enzymes [BR:hal01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     VNG1344G (dchpS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1002833..1003978)
Genome map
AA seq 381 aa AA seqDB search
MSVPPSSRDMRTVDAAGLPIGDDYPPRIMGVLNVSKESPYDPSVYDDPEAAAAYVDSELI
GEGADIVDVGLESANKDLDVLSADQERERLQTAIDTIERVEGEAVFSIETRYSEVADEAL
AAGFDMVNDICGFADPEMPAVCEAHDVAVAKMASPPDLERPGAIESVDDIYDALSLHGFT
DKTIVDPAFGGWSTEKTLADDRETFDRLREFRGYGYPMLVSINRKNFLREIAGRDTAGAL
PVSLAATAMAVERGAHVVRTHDVAETRDAALIGHEFTPDRTHTSHIEQLDVTTLPAAMRH
ADRLGADGAADAVARAYEVTGLSADDRDALAATGVAVSGTDPTLVAGTAGALREAGAGLA
AATDGDSVLATLAEIFRTAGE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgccgccatccagtagggatatgcgaaccgtcgacgcagccgggctgcccatc
ggtgacgactacccgccacgaatcatgggcgtgttgaacgtatcgaaggagtcgccgtac
gacccgagcgtgtacgacgaccccgaggcggcggccgcgtacgtcgactcggagctgatc
ggggagggcgctgacatcgtcgatgtcggcctggagtccgcgaacaaggacctcgacgtg
ctgtcggccgaccaggagcgcgagcgcctccagacggccatcgacaccatcgagcgcgtc
gagggggaggcggtgttctccatcgaaacccggtacagcgaggtcgccgacgaggcgctg
gcggctggcttcgacatggtcaacgacatctgtgggttcgcggaccccgagatgccggcg
gtctgtgaggcccacgacgtcgcggtcgcgaagatggcgagcccgccggacctcgaacgc
ccgggggccatcgaatccgtcgacgacatctacgacgcgctgtcgctgcacgggttcacc
gacaagaccatcgttgatccggcgttcggcgggtggagcaccgagaagacgctggccgac
gaccgcgagacgttcgaccggctgcgggagttccgcgggtacggctacccgatgttggtt
tcgatcaaccgcaagaacttcctgcgggagatcgccggccgggacacggcgggggcgctg
ccggtgtcgctggcggcgaccgcgatggccgtcgagcgcggcgcacacgtggttcggacc
cacgacgtcgccgagacgcgtgacgcggcgctcatcggccacgagttcacgcccgaccgc
acgcacaccagccacatcgaacagttggacgtgacgacgctcccggcggcgatgcgccac
gccgaccggctcggcgctgatggggcggccgacgccgtcgcgcgcgcctacgaggtcacg
gggctgtcggccgacgaccgggacgcgctggcggcgactggggtcgcggtctccggcacg
gacccgacgctcgtcgccggcacagcgggggcgctccgtgaggctggcgcggggctggcg
gccgccacggacggcgacagcgtgcttgcaaccctggcggagatattccggacggccggg
gagtaa

DBGET integrated database retrieval system