KEGG   Halobacterium sp. NRC-1: VNG1444GHelp
Entry
VNG1444G          CDS       T00038                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VNG1444G (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    VNG1444G (hisD)
Enzymes [BR:hal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     VNG1444G (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1070493..1071770
Genome map
AA seq 425 aa AA seqDB search
MEYEAVADLAPDRRVALFERDAGVDAVRSDVAEILDRVESEGDVALRALASEFDDVEVGN
LDVTDEMERAADAVPDDVYDAIEDAAANIRAFHEAQLPDDWRESFAAGRELGRRFRPVRR
VGVYAPGGTAAYPSSVLMGVIPAVVAGVEQVAVATPPAETINPVTLAAAHAAGADRVYQV
GGAQAIGAFAYGTETVDTVQTVVGPGNKWVTAAKAEVRGDVEIDFLAGPSELLVVADETA
EPAFVAADLLAQAEHDPNASVVAVTDDEATAAAITDAVAARLDDRERADTIRAALDNEAS
GVFVARSMSEAVMFAEEYAAEHLSIQASDDEALLDRIDSAGSVFLGGYAPVAAGDYAAGT
NHVLPTNGTARVTGGLSVDTFLRSTTVQRLDREGLAALRETVTTLADAEGLEGHAASVDA
RFEDE
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggagtacgaagccgtcgccgacctcgcgccggatcgccgggtggcgttgttcgaacgg
gacgccggcgtcgacgccgtgcgctcggacgtggcggaaatcctcgaccgcgtggagagc
gagggcgacgttgcgctgcgggcgctcgccagcgagttcgacgacgtcgaggtcgggaac
ctggacgtcaccgacgagatggagcgcgccgctgacgcggtgcccgacgacgtgtacgac
gccatcgaggacgccgcggcgaacatccgggcgttccacgaggcccagttgcccgacgac
tggcgggagtcgttcgctgcggggcgggagctggggcggcgcttccggcccgtgcggcgg
gtgggcgtgtacgcacccggcggcacggcagcatacccgtcgtcggtgttgatgggggtg
atcccggcggtagtggcgggcgtcgaacaggtggccgtggcgacgccgcccgccgagacg
atcaaccccgtcaccctggcggcggcgcacgccgccggcgcggaccgcgtctaccaggtc
gggggcgcgcaggccatcggcgcgttcgcgtacggcaccgagacggttgacaccgtccag
acggtcgtcggccccggcaacaagtgggtgacggcggccaaagccgaggtgcggggcgac
gtggagatcgacttcctggcgggcccctccgagttgctcgtggtcgcggacgaaaccgcg
gagccggcgttcgtcgccgccgacctgctcgcgcaggccgaacacgacccgaacgcgagc
gtggttgccgtcaccgacgacgaggcgaccgccgccgcgatcaccgacgcggttgcggcc
cgcctcgacgaccgcgaacgcgccgacaccattcgggccgccctcgacaacgaggccagc
ggcgtgttcgtcgcgcggtcgatgagcgaggccgtgatgttcgccgaggagtacgccgcc
gaacacctctcgatccaggccagcgacgacgaggcactgctggaccgcatcgacagcgcc
ggctcggtgttcctcggcgggtacgcgcccgtcgccgccggcgattacgccgccggcacc
aatcacgtgttgcccaccaacgggactgcacgggtcaccggcggcctgagcgtcgacacg
ttcctgcggtcgacgacggtccagcgcctcgaccgcgaggggctggcggcgctccgggag
acggtgaccacgctggccgacgccgagggacttgaggggcacgcggccagcgtcgacgct
cggttcgaggacgagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system