KEGG   Halobacterium sp. NRC-1: VNG1498GHelp
Entry
VNG1498G          CDS       T00038                                 

Gene name
celM
Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VNG1498G (celM)
Enzymes [BR:hal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     VNG1498G (celM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1110649..1111710)
Genome map
AA seq 353 aa AA seqDB search
MDDARRTFLDELLAVHSPTGHEAAAQRVWVEYVSQYADRVETDAYGNAVAVAEGGAPAVA
FTGHADEIGFAVAEITEGGFVRIAPIGGLDASVTRGSQVRIETDDGPVNGVIGQAAVHLR
DHSEDGAAPSVTEQYVDIGAADGDDARDRVSVGDPGVLVSEPRELAGGRLNARSLDNRTG
LWVAAEGFRRAVERDVDATVYAVSTVHEEIGTRGARMVGFDLDVDAVVAADVTHAADDPM
YPAERASTVALGDGPVVMRGGTNHPVVVSALRDAAADAGASLQVAAHRISTGTDADAFGT
AGGGVPTADLGIPNRYMHTPAEVVDLADLAAGADVLAAFAAHAGDRDSFGVSV
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggacgatgcgcgtcgcacgttcctggatgagttgctcgcagtccacagcccgaccggc
catgaggcggccgcacagcgcgtgtgggtggagtacgtctcgcagtacgccgaccgcgtg
gagacggacgcctacgggaacgccgtggccgtcgccgagggcggcgcgcccgcggtggcg
ttcaccgggcacgccgacgagatcgggttcgcggtggccgagatcaccgagggggggttc
gttcggatcgccccgatcggcgggctggatgcgtccgtgacgcggggcagccaggtccgg
atcgagaccgacgacggccccgtcaacggggtcatcgggcaggcggcggttcatctgcgg
gaccacagcgaggacggcgccgcgccgtcggtgaccgagcagtacgtcgacatcggggcg
gcggacggcgacgacgctcgtgaccgtgtgtccgtgggcgatccgggggtgctcgtctcc
gagccccgggagctggccggcggccggctgaacgcgcgcagcctcgacaaccgcaccggg
ctgtgggtggccgccgaggggttccggcgcgccgtcgaacgcgacgtcgacgcgacggtg
tacgcagtgagcacggtccacgaggagatcggcacccgcggcgcacggatggttgggttc
gacctcgacgtggacgccgtggtcgccgccgacgtgacccacgccgccgacgatccgatg
tatccggccgagcgcgcgagcacggtcgcgctcggcgacggccccgtggtgatgcgcggc
ggcacgaaccaccccgtggtggtgtccgcgcttcgtgacgccgcagccgacgccggggcg
tcgctgcaggtcgccgcccaccggatctcgactggcacggacgccgacgcgttcgggacg
gcgggtggcggggtgccgaccgccgacctggggatcccgaaccggtatatgcatacgccg
gcggaggtcgttgatctggcggacctcgctgcgggggcggacgtgctcgcggcgttcgcc
gcccacgccggggaccgggactcgtttggggtctcggtctga

DBGET integrated database retrieval system