KEGG   Halobacterium sp. NRC-1: VNG1510CHelp
Entry
VNG1510C          CDS       T00038                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
hal  Halobacterium sp. NRC-1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1121952..1123601)
Genome map
AA seq 549 aa AA seqDB search
MSSNADDGAFQAACEELVSRILAGDVGKDDIEDAKLDVCGEYAASKVPKHSDLLDVAPDG
RRDELEDVLQRKPVRTASGVTPVAIMTSPHTCPHGKCLYCPGGPASEFTSSQSYTGHEPA
AARGVQNDYDPYGQVTLRLHQLRQIGHPVDKVELILMGGTMTARSHDYQEWFVKRALQAL
NDFDPDQEPAPNQTESFAQDPAEYDFRYLEDVIADNEHGALRNIGTTFETKPDWCDPEQV
DRMLDLGATKVEVGVQTTFERVNREMHRGHGVQASVDANRRLRDAAFKVGFHMMPGQPGM
SKEMVLEDFRRLFDDERWKPDYLKIYPTLVVRDTITYDMWRNGDFEPLHNEEAADLVAEI
KDMIPRYTRLQRVQRDIPADFIDAGVWKSNLRQLARQRMAEHGYTCDCIRCREAGMNDDD
PENVSLDVETYAAGGGTEQFISIEDFQQDLLVGFARLRFPNEPAREELTDAALLRELHVY
GSEVSVGDDTGDDQHQHQGYGRQLMERAEHLAADSGFEKLSVISGIGARQYYKQQLGYHQ
DGPYVSKRL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtaacgccgacgacggcgcgttccaggccgcctgcgaggagctcgtctcccgg
atcctcgccggtgatgtcggcaaagacgacatcgaggacgcgaaactcgacgtctgtggt
gagtacgccgcgtcgaaggtgcccaaacactccgacctcctggacgtggcgccggacggc
cggcgggacgaactggaggacgtgctccagcgcaagccggtgcggacggcgtccggggtg
acgcccgtcgcgatcatgaccagcccccacacctgcccgcacggcaagtgtctgtactgt
ccgggcggcccggcgagcgagttcacgtccagccagtcgtataccggccacgagcccgcc
gctgcgcgcggcgtgcaaaacgactacgacccgtacggccaggtgaccctgcgcctccac
cagctccgccagatcggccacccggtcgacaaggtggagctcatcctgatgggggggacg
atgaccgcgcgcagccacgactaccaggagtggttcgtgaagcgcgcgctgcaagcgctc
aacgacttcgaccccgaccaggagcccgcacccaaccagacggagtcgttcgcccaggac
cccgcggagtacgacttccggtatctggaggacgtcatcgccgacaacgagcacggggcg
ctccggaacatcggcacgacgttcgagacgaaacccgattggtgtgaccccgagcaggtc
gaccggatgctggatctcggcgcgacgaaagtcgaggtgggcgtccagaccaccttcgag
cgcgtgaaccgcgagatgcatcggggccacggcgtgcaggcgtccgtggacgccaaccgg
cggctgcgggacgccgcgttcaaagtcgggttccacatgatgcccggccagcccggcatg
agcaaggagatggtgttggaggacttccggcggctgttcgacgacgagcgctggaagccc
gactacctcaagatctacccgacgctggtggtgcgggacaccatcacctacgacatgtgg
cgcaacggcgacttcgagcccctgcacaacgaggaggccgccgacctcgtcgcggagatc
aaggacatgatcccgcggtacacgcgcctgcagcgcgtccagcgggacatccccgcggac
ttcatcgacgccggcgtctggaagtccaacctgcgccagctcgcccgccagcgcatggcc
gagcacggctacacctgcgactgcattcgctgccgtgaggccgggatgaacgacgacgac
cccgagaacgtcagcctcgacgtggagacgtacgctgccggcggcggcacggagcagttc
atcagcatcgaggacttccagcaggacctcctggtggggttcgcgcgcctgcggttcccc
aacgagccggcgcgcgaggagctgaccgacgccgcgctgttgcgggagctccacgtctac
ggcagcgaggtgagcgtcggcgacgacaccggcgacgaccaacaccaacaccagggctac
gggcggcagctcatggagcgcgccgagcacctggccgccgacagcggcttcgagaagctg
tcggtcatctccggcatcggggcgcgccagtattacaagcagcagctcggctaccaccaa
gacggcccgtacgtctccaagcgcctctga

DBGET integrated database retrieval system