KEGG   Halobacterium sp. NRC-1: VNG1541GHelp
Entry
VNG1541G          CDS       T00038                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VNG1541G (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VNG1541G (sucC)
   00640 Propanoate metabolism
    VNG1541G (sucC)
   00660 C5-Branched dibasic acid metabolism
    VNG1541G (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    VNG1541G (sucC)
Enzymes [BR:hal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     VNG1541G (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1148259..1149530
Genome map
AA seq 423 aa AA seqDB search
MHTHHMDGARCKRMHPVSKRQHAPDSETDGVYAERGSRSDCMKLHEYQAKEVFADAGIPT
PESALATSVDEAVEVADALDYPVAVKAQVHVGGRGKAGGIKLAENTAEAREAAESILGMD
LKGYTVDRVLVEEAVDFTNELYVGVTMDRSEGAPVVMVSERGGVDIESVAEEAPEDIVRE
HVDPSFGLQAYQARNAVYDAGIEQDVAGDVAKIVQGVYDLWADSDATEVEINPVMVTSER
DVVAADAVMKLDEDALFRQPAFADMEEDAAEDDLEAKANEYGFDYVRLDGNTGIIGNGAG
LVMTTLDLVDYYGGQPANFLDIGGGAKADRVANALDMVFSDENVDSVVFNIFGGITRGDE
VAKGINSALEQFDEIPTPVVVRLAGTNAAEGREILNDDLVTVEETLEGAVQRAVEYADEE
DIQ
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcatacacaccacatggatggcgcgcgttgtaaacgtatgcaccccgtgtcgaagcgg
cagcacgcgccggattcggagaccgatggggtttatgctgagcgaggttcgcgttcagac
tgcatgaagcttcacgagtaccaggcgaaggaggtcttcgccgatgcgggcattccgacc
ccggagtcggcgctcgcaacgtccgtcgacgaggccgtcgaggtcgcagacgccctcgac
taccccgtcgcggtgaaggcccaggtacacgtcggtggccgcggaaaggccggcggcatc
aaactcgcggagaacacggccgaggctcgcgaggccgccgagtcgattctcggcatggac
ctcaaaggctacacggttgatcgcgttctcgtcgaggaggccgtcgacttcaccaacgag
ttgtacgtcggcgtgaccatggaccgcagcgagggcgcgccggtcgtgatggtctccgag
cgcggcggcgtcgacatcgaatccgtcgccgaggaagcccccgaggacatcgtgcgcgag
cacgtcgatccctcgttcggtctgcaggcctatcaggcccgcaacgccgtctacgacgcg
ggcatcgagcaggacgtcgccggggacgtcgcgaagatcgtgcagggcgtctacgatctg
tgggcggacagcgacgccacggaggtcgagatcaatcccgtgatggtgaccagcgagcgc
gacgttgtcgccgccgacgccgtgatgaaactcgacgaggacgcgttgttccgccagccg
gcgttcgccgacatggaagaggacgccgccgaggacgacctcgaagccaaggccaacgag
tacggcttcgactacgtccgcctggacggcaacacgggcatcatcggcaacggggccggg
ctcgtgatgacgacgcttgacctcgtggactactacggcgggcagcccgcgaacttcctg
gacatcggcggcggcgcgaaagccgaccgcgtcgccaacgccctggacatggtgttcagc
gacgagaacgtcgacagcgtcgtgttcaacattttcggcggcatcactcgcggcgacgag
gtcgcgaagggcatcaacagcgcgctcgaacagttcgacgagatcccgacgccggtcgtc
gtccggctcgcgggcacgaacgccgctgaaggccgcgagatcctcaacgacgacctcgtg
accgtcgaagaaacgcttgagggcgctgtccagcgcgccgtcgagtacgccgacgaggag
gacatccaatga

DBGET integrated database retrieval system