KEGG   Halobacterium sp. NRC-1: VNG1541GHelp
Entry
VNG1541G          CDS       T00038                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VNG1541G (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VNG1541G (sucC)
   00640 Propanoate metabolism
    VNG1541G (sucC)
   00660 C5-Branched dibasic acid metabolism
    VNG1541G (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    VNG1541G (sucC)
Enzymes [BR:hal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     VNG1541G (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1148259..1149530
Genome map
AA seq 423 aa AA seqDB search
MHTHHMDGARCKRMHPVSKRQHAPDSETDGVYAERGSRSDCMKLHEYQAKEVFADAGIPT
PESALATSVDEAVEVADALDYPVAVKAQVHVGGRGKAGGIKLAENTAEAREAAESILGMD
LKGYTVDRVLVEEAVDFTNELYVGVTMDRSEGAPVVMVSERGGVDIESVAEEAPEDIVRE
HVDPSFGLQAYQARNAVYDAGIEQDVAGDVAKIVQGVYDLWADSDATEVEINPVMVTSER
DVVAADAVMKLDEDALFRQPAFADMEEDAAEDDLEAKANEYGFDYVRLDGNTGIIGNGAG
LVMTTLDLVDYYGGQPANFLDIGGGAKADRVANALDMVFSDENVDSVVFNIFGGITRGDE
VAKGINSALEQFDEIPTPVVVRLAGTNAAEGREILNDDLVTVEETLEGAVQRAVEYADEE
DIQ
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcatacacaccacatggatggcgcgcgttgtaaacgtatgcaccccgtgtcgaagcgg
cagcacgcgccggattcggagaccgatggggtttatgctgagcgaggttcgcgttcagac
tgcatgaagcttcacgagtaccaggcgaaggaggtcttcgccgatgcgggcattccgacc
ccggagtcggcgctcgcaacgtccgtcgacgaggccgtcgaggtcgcagacgccctcgac
taccccgtcgcggtgaaggcccaggtacacgtcggtggccgcggaaaggccggcggcatc
aaactcgcggagaacacggccgaggctcgcgaggccgccgagtcgattctcggcatggac
ctcaaaggctacacggttgatcgcgttctcgtcgaggaggccgtcgacttcaccaacgag
ttgtacgtcggcgtgaccatggaccgcagcgagggcgcgccggtcgtgatggtctccgag
cgcggcggcgtcgacatcgaatccgtcgccgaggaagcccccgaggacatcgtgcgcgag
cacgtcgatccctcgttcggtctgcaggcctatcaggcccgcaacgccgtctacgacgcg
ggcatcgagcaggacgtcgccggggacgtcgcgaagatcgtgcagggcgtctacgatctg
tgggcggacagcgacgccacggaggtcgagatcaatcccgtgatggtgaccagcgagcgc
gacgttgtcgccgccgacgccgtgatgaaactcgacgaggacgcgttgttccgccagccg
gcgttcgccgacatggaagaggacgccgccgaggacgacctcgaagccaaggccaacgag
tacggcttcgactacgtccgcctggacggcaacacgggcatcatcggcaacggggccggg
ctcgtgatgacgacgcttgacctcgtggactactacggcgggcagcccgcgaacttcctg
gacatcggcggcggcgcgaaagccgaccgcgtcgccaacgccctggacatggtgttcagc
gacgagaacgtcgacagcgtcgtgttcaacattttcggcggcatcactcgcggcgacgag
gtcgcgaagggcatcaacagcgcgctcgaacagttcgacgagatcccgacgccggtcgtc
gtccggctcgcgggcacgaacgccgctgaaggccgcgagatcctcaacgacgacctcgtg
accgtcgaagaaacgcttgagggcgctgtccagcgcgccgtcgagtacgccgacgaggag
gacatccaatga

DBGET integrated database retrieval system