KEGG   Halobacterium sp. NRC-1: VNG1767GHelp
Entry
VNG1767G          CDS       T00038                                 

Gene name
speB
Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    VNG1767G (speB)
Enzymes [BR:hal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     VNG1767G (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1308056..1308874)
Genome map
AA seq 272 aa AA seqDB search
MFPGASTADESNPGADADYVVVGAPLDVSTSFQPGTRFGPGELRTYAATFEDYHHRTGTH
FSALSVTDYGDVRAWNDVPAYLEYLNGVVTDISWNDATPLLVGGEHTVTVAAVRALNPDV
FVALDAHLDLRAALDGDPLSHSTVTRHALDVADEAIVVGARAGSEEEWERAADSDVTVIE
PSAVADWTPAFGDADVYLSVDIDAADPGYAPGTGTPEPFGMSPRELRAAVRAVAPHAVGF
DVVEVNDRDDGQAPTLGAKLLREFVHTHHADG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgttccctggcgccagcaccgccgacgagtcgaaccccggagccgacgccgactacgtc
gtcgttggggcgcccctcgacgtgtcgacgtcgttccagccgggcacccgtttcggcccc
ggtgaactccggacgtacgccgcgaccttcgaggactaccaccaccggacgggcacgcac
ttctccgccctctcggtcactgactacggcgacgtgcgcgcgtggaacgacgtgccggcg
tacctcgaatacctcaacggcgtcgtcaccgacatctcgtggaacgacgccacgccgctg
ctcgtcggcggcgaacacacggtgaccgtggcggcggttcgcgccctgaacccggacgtg
ttcgtggccctggacgcccacctcgatctgcgcgctgccctcgacggtgatccgctgagc
cactcgacggtgacgcgccacgccctcgacgtggccgacgaagcgatcgtcgtgggcgca
cgcgccggctccgaggaggagtgggagcgcgccgccgactctgacgtgaccgtgatcgag
ccgagcgccgtcgccgactggacgccggcgttcggcgacgcggacgtgtacctgagcgtg
gacatcgacgccgccgatccggggtacgcgccgggcaccgggacgccggagccgttcggg
atgtcgccacgggagctccgggcggccgtgcgcgcagtcgccccgcacgctgtcgggttc
gatgtcgtggaggtcaacgaccgggacgacggccaggcccccaccctcggcgcgaagctg
ctgcgcgagttcgtgcacacgcaccacgccgacgggtaa

DBGET integrated database retrieval system