KEGG   Halobacterium sp. NRC-1: VNG1967GHelp
Entry
VNG1967G          CDS       T00038                                 

Gene name
glpK
Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    VNG1967G (glpK)
Enzymes [BR:hal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     VNG1967G (glpK)
Exosome [BR:hal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VNG1967G (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1451162..1452694)
Genome map
AA seq 510 aa AA seqDB search
MTDAYVGAIDQGTTGTRFIVFDQHGDVVANTYEKHEQHYPEPGWVEHDPLEIWENTKSVV
TAGLSAAGLDADDLAAIGITNQRETTVVWDAASGRPIHNALVWQDRRTTSRVESLEENGK
IERIREKTGLEADAYFSATKTEWLLDEAEPLKLSSARASSLRDRARDGELLMGTIDSWLI
YNLTGEHITDVSNASRTMLYNITDLEWDDWLLEEFDIPREMLPEVRPSSDEAVYGHTDPD
GFLGAAVPVTAALGDQQAALFGQTCFDAGDAKNTYGTGSFYLMNTGEDAVSSEHGLLTTI
GFQLSGEPVQYALEGSIFVTGAAIEWLEDVDLINNAAQTAELASSVDTTDGVYMVPAFTG
LGAPHWDGRARGTLVGMTRGTRKAHIVRATLESIAYQTRDIAAAMEADSGVSTTTLRVDG
GAVKNNFLCQLQSDIIQTDLARPEVDETTALGAAYAAGLAVGYWDSLDDLRENWRVDRSF
EPEMDPSEADSKYGRWEDAVDRSLAWATED
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgcatacgtcggcgcgatcgaccaagggacgacaggcacgcggttcatcgta
ttcgaccaacacggcgacgtggtcgcgaacacctacgagaaacacgaacagcactacccc
gaacccggctgggtcgaacacgaccccctggagatctgggagaacacgaaaagcgtcgtc
acggcggggctctcggccgccgggctggacgccgatgacctcgccgcgatcggcatcacg
aaccagcgcgagaccaccgtagtctgggacgccgcaagcggccgcccgatccacaacgcc
ctcgtctggcaggaccgacgcaccaccagccgcgtcgaatccctggaggaaaacggcaag
atcgagcgcatccgcgagaaaaccggcctggaggcggacgcctacttctcggccacgaaa
accgagtggctgctcgacgaagccgagccgctgaagctctcctcggcgcgcgccagcagc
ctccgggatcgcgcccgcgacggcgagttgctcatgggcaccatcgactcctggctcatc
tacaacctcaccggcgaacacatcacggacgtgtcgaacgcctcccggacgatgttgtac
aacatcaccgacctggagtgggacgactggctgctggaggagttcgacatcccccgggag
atgctgccggaagtacggccgtcctctgacgaggccgtctacgggcacaccgaccccgac
ggcttcctcggcgcggcagttcccgtcacggccgcgctgggcgaccagcaggcggccctc
ttcgggcagacgtgtttcgacgccggcgacgccaagaacacgtacggcaccggctcgttc
tacctcatgaacaccggcgaggacgccgtctcctccgagcacggcctgctcacgacgatc
gggttccagctctccggggagcccgtccagtacgccctcgaggggtcgatcttcgtcacg
ggcgcggcgatcgagtggctcgaagacgtcgacctcatcaacaacgccgcccagaccgcg
gaactcgccagctccgtcgacaccaccgacggcgtctacatggtgcccgcgttcaccggg
ctgggcgcgccacactgggacggccgcgcccgcggcaccctcgtcggcatgacgcggggc
acgcggaaagcccacatcgttcgggcgaccctcgaatcgatcgcctaccagacccgcgac
atcgcggcggcgatggaggccgactccggggtgtccaccacgacgctgcgcgtcgacggc
ggcgcggtcaagaacaacttcctctgccagctgcagtcggacatcatccagaccgacctc
gcgcgcccggaggtcgacgagaccaccgcgctcggggcggcctacgcggccggcctggcg
gtcggctactgggacagcctggacgacctccgggagaactggcgtgtcgaccggtcgttc
gagccggagatggaccccagcgaggccgacagcaagtacggccgctgggaggacgccgtt
gatcgctcgctggcgtgggccacggaggactga

DBGET integrated database retrieval system