KEGG   Halobacterium sp. NRC-1: VNG2108GHelp
Entry
VNG2108G          CDS       T00038                                 

Gene name
thrC3
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hal01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hal00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:hal00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1548632..1549723
Genome map
AA seq 363 aa AA seqDB search
MLVCRSCGATYETGPEEPWRCRACEHAVDFAERPRATGDPTAVDPTAGLWAFSEFLPVAA
DDAVSLGEGWTPLVSASEWDAEFKLDYVCPSGSYKDRGAAVLMTRAAALGVDRVVEDSSG
NAGAAVAQYAARAGIDAEIYVPADAPAAKLDAMEAAGATTVPVAGGRRAVTEACVSEAVG
SDAWYASHAWSPSFYAGTATVAYEIAAQRGWRAPDAVVVPVGHGTLLLGAYRGFRALAAG
GWIESMPRLLGVQAAGVEPVAAAVNGSASDEDAVNEAADGIQIRSPARLDQVAAAVAATD
GDVVACDESATTDALASLHEAGLYVEPTSAVAVAGLAAYRARGVVGDSDDVVVALTGSGL
KKP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtgtgccggtcgtgtggcgcgacgtacgagacgggtcccgaggagccgtggcgc
tgccgggcgtgtgagcacgccgttgatttcgccgagcgcccacgggcgaccggggacccg
acggcggtcgatccgacggcggggctgtgggcgttctcggagttcctgccggtggccgcc
gacgatgccgtgtcgctgggggaagggtggacgccgttggtgtcggcgtccgagtgggac
gccgagttcaaactcgattacgtgtgtccgtcgggcagctacaaggaccgcggcgcggcg
gtgctgatgacgcgggcggcggcgctgggtgtggatcgcgtcgtcgaggactcgtcgggg
aacgccggggcggcggtcgcgcagtacgccgcgcgggcgggcatcgacgcggagatctac
gtgccagcggacgccccggcggcgaagctggacgcgatggaggccgccggcgcgacgacc
gtgccggtggcgggcggacggcgtgcggtgaccgaggcgtgcgtcagcgaggccgtcggg
agcgacgcgtggtacgccagccacgcgtggtcgccgtcgttctacgccgggacggcgacg
gtcgcctacgagatcgccgcccagcgggggtggcgtgcgccggacgcggtggtggtgccc
gtcggccacggcacgctgctgttgggcgcgtaccgggggtttcgggcgctcgccgcgggc
ggctggatcgaatcgatgccacgactgctgggggtgcaggcggcgggcgtggagccggtc
gccgcggcggtcaacgggtcggcatcggacgaagacgcggtcaacgaggcggccgacggg
attcagatccggtcgccggcccgcctggatcaggtggcggctgcggtggcggcgaccgac
ggcgacgtggtggcgtgtgacgagtcagcgaccacggacgcgctggcgtcgctgcacgag
gccgggctgtacgtcgagccgacgagtgcggtggctgtcgcggggcttgcggcgtaccga
gcccgcggcgtggtcggtgacagcgatgacgtggtcgttgcgttgaccggcagcggcctg
aagaagccctaa

DBGET integrated database retrieval system