KEGG   Halobacterium sp. NRC-1: VNG2206GHelp
Entry
VNG2206G          CDS       T00038                                 

Gene name
pmu1
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VNG2206G (pmu1)
   00030 Pentose phosphate pathway
    VNG2206G (pmu1)
   00051 Fructose and mannose metabolism
    VNG2206G (pmu1)
   00052 Galactose metabolism
    VNG2206G (pmu1)
   00500 Starch and sucrose metabolism
    VNG2206G (pmu1)
   00520 Amino sugar and nucleotide sugar metabolism
    VNG2206G (pmu1)
  Nucleotide metabolism
   00230 Purine metabolism
    VNG2206G (pmu1)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    VNG2206G (pmu1)
Enzymes [BR:hal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     VNG2206G (pmu1)
    5.4.2.8  phosphomannomutase
     VNG2206G (pmu1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1635310..1636677
Genome map
AA seq 455 aa AA seqDB search
MNVFGSSGTRGVANEELTPGFVLRVAKAAGSVWRADRVAVARDTRTTGRMLENAAVAGLQ
SIGVDVDRLGVVPTPATQAYAERAGVPAVMVTASHNPSQYNGVKLVGSDGVELAVADLER
VERAFTTEQFDNAAWDGVGADREVASAGRDYRAQLSDAVDRAAIAAADLTVALDPGHGAG
ALTSPTFYRELGCDVVTVNAQPDGHFPGREPEPVREHLGDLGALVRAADADVGIAHDGDA
DRAIFVDETGEYIEGDATLAALAEAELDAGDTTVSAVNVSQRLVDVCDRTGATLELTPIG
STQIMTRIRELEAEGDHVPVAGEGNGGIIFPEYRMTRDGAYTGARFLELLADGTPASEVV
APYDDYHNVRVNVDYDTEAQRGALLDAAEARALDADADRTTIDGYRLDYGDAWVLVRPSG
TEPVVRIYAESTDHERAESLAEAFAADLRAARADA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcttcgggtcgagcggaacgcggggcgtggccaacgaggagctcacaccgggg
ttcgtgttgcgcgtcgcgaaggcggccggctcggtgtggcgcgccgaccgcgtcgcggtc
gcacgggacacccgaaccaccggccgcatgctcgaaaacgcggccgtcgcgggcctccag
agcatcggcgtggacgtcgaccggctcggggtggttccgacgccggccacgcaagcgtac
gcggagcgcgccggcgtcccggcggtgatggtgaccgcgagtcacaaccccagccagtac
aacggcgtcaagctcgtcggcagcgacggcgtcgagctggcggttgccgacctggagcgc
gtggagcgcgcgttcaccaccgagcagttcgacaacgccgcctgggacggtgtgggagcc
gaccgggaggtggcgtccgcgggccgcgactaccgcgcacagctgtccgacgccgtcgac
cgggcggcgatcgcggccgccgacctgacggtcgccctggacccgggccacggcgcgggc
gcgctcaccagcccgacgttctaccgcgagctcgggtgtgacgtcgtcaccgtgaacgcc
cagccggacggccacttccccggccgggagcccgagccggtgcgcgaacacctcggcgac
ctcggcgcactcgtgcgcgcggccgacgccgacgtggggatcgcccacgacggcgacgcc
gaccgtgccatcttcgtcgacgagaccggcgagtacatcgagggcgacgccacgctcgcg
gcgcttgcggaggccgagctcgacgccggcgacaccacggtgtccgcggtgaacgtcagc
cagcgcctcgtggacgtctgcgaccgcactggagcgacgcttgagctcacgcccatcggc
tccacgcagatcatgacccggatccgcgagctggaagccgagggcgaccacgtcccggtg
gccggcgagggtaacggcgggatcatcttcccggagtaccgcatgacccgcgacggcgcg
tacactggcgcacggttcctcgaactgctggccgacggcacgcccgcaagcgaggtcgtc
gcgccgtacgacgactaccacaacgtccgcgtgaacgtcgactacgacacggaagcacaa
cggggggcgctcctcgacgcggcggaggcgcgcgcgctggacgcggacgccgaccgcacc
accatcgacggctaccggctggactacggcgacgcctgggtgctcgtgcggccgtcgggc
acggagccggtcgtccgcatctacgcggagtccaccgaccacgagcgggccgaatccctc
gcggaggcgttcgccgcggatctgcgcgcggcgcgggccgacgcctag

DBGET integrated database retrieval system