KEGG   Halobacterium sp. NRC-1: VNG2220GHelp
Entry
VNG2220G          CDS       T00038                                 

Gene name
lpdA
Definition
LpdA
Orthology
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VNG2220G (lpdA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VNG2220G (lpdA)
   00020 Citrate cycle (TCA cycle)
    VNG2220G (lpdA)
   00620 Pyruvate metabolism
    VNG2220G (lpdA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VNG2220G (lpdA)
   00280 Valine, leucine and isoleucine degradation
    VNG2220G (lpdA)
Enzymes [BR:hal01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     VNG2220G (lpdA)
Exosome [BR:hal04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   VNG2220G (lpdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1649819..1651243
Genome map
AA seq 474 aa AA seqDB search
MVVGDISTGTDVAVVGAGPGGYVAAIRAGQLGLDVTLVEKDAYGGTCLNYGCIPSKAMIT
ASGVAHEAGHAEEMGVYADPDVDVAEMVDWKDGVVDQLTGGVEKLCKANGVNLIEGRAEF
AGSDKLRVVHGGDGQGSETIEYEHAIVSTGSRPIEVPGFDFGDDPVLDSRQALAMAELPS
SMVIVGGGYIGMELSTVFAKLGVDVTVVEMLDGILPQYGDDIARPVRQRAEELGIDFHFG
LAADSWTDTDDGIVVTAADEDGEETEFETEKVLVAVGRQPVTDTLNLDAVGLEPNDDGRL
ETDHEARTDVENVFAIGDVAPGPMLAHKASKEGEVAAEVIAGEPAALDYQAVPAAVFTDP
EIGTVGLTEDDAAAQGFDPVVGTFPFNASGRALTTGHDDGFVEVVADEESGFLLGAQIVG
PEASELVAELGLAIEMGATLEDVASTIHTHPTLSEATMEAAEHALGHAVHTLNR
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcggagacatctcgactgggacggacgtcgcggtcgttggcgctggccccggt
ggctacgtggcggcgatccgcgcgggacagctcggcctcgacgtgacgctcgtcgagaag
gacgcctacggcggcacctgcttgaactacggctgcatcccgtcgaaggcgatgatcacg
gcgtcgggcgtcgcccacgaggcgggccacgccgaggagatgggcgtgtacgccgacccc
gacgtggacgtggcggagatggtcgactggaaggacggcgtcgtcgaccagctcacgggc
ggcgtggagaagctctgcaaggccaacggcgtgaacctcatcgaggggcgcgcggagttc
gcgggcagcgacaagctgcgggtcgtgcacggcggcgacggccagggctcggagaccatc
gagtacgagcacgccatcgtgtcgacgggctctcggcccatcgaggtgccgggcttcgac
ttcggcgacgaccccgtgttggattcgcggcaggcgctggcgatggcggagctgccgtcg
tcgatggtgatcgtcggcggcggctacatcggcatggagctgtcgacggtgttcgcgaag
ctcggcgtggacgtgaccgtcgtggagatgctggatggcatcctgccacagtacggcgac
gacatcgcgcgccccgtgagacagcgcgccgaggaactcggcatcgacttccacttcggc
ctcgcggccgacagctggacggacaccgacgacggcatcgtggtcaccgccgccgacgag
gacggcgaggagaccgagttcgagaccgagaaggtgctcgtggcggtcggccgccagcca
gtcaccgacacgctgaacctggacgccgtcggcctcgaaccgaacgacgatgggcgcctg
gagaccgaccacgaggcccgcaccgacgtcgagaacgtcttcgcgatcggcgacgtcgcg
cccggcccgatgctcgcgcacaaggccagcaaggagggcgaggtcgccgcggaagtcatc
gcgggcgagccggcggccctggactaccaggccgtgccggcggcggtgttcaccgacccc
gagatcgggaccgtcgggctcaccgaggacgacgccgccgcgcagggcttcgacccggtc
gtcgggacgttcccgttcaacgccagcgggcgcgcgctcaccacgggccacgacgacggc
ttcgtggaggtcgtcgccgacgaggagtcggggttcctgctgggcgcgcagatcgtcggc
ccggaggccagcgagctcgtcgccgagctcggcctcgcgatcgagatgggggccaccctg
gaggacgtcgcgtccaccatccacacgcatccgacgctgtccgaggccacgatggaggcc
gccgagcacgcgctcggccacgccgtccacacgctgaaccggtaa

DBGET integrated database retrieval system