KEGG   Halobacterium sp. NRC-1: VNG2322GHelp
Entry
VNG2322G          CDS       T00038                                 

Gene name
hem2
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VNG2322G (hem2)
Enzymes [BR:hal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     VNG2322G (hem2)
Exosome [BR:hal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VNG2322G (hem2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1731824..1732804
Genome map
AA seq 326 aa AA seqDB search
MELPHRPRRLRRDGVRDLVSETMLTPADLVAPVFVDATADERTPIPSMPGQERVPLADAV
DRTREILDTGVEAIVLFGIPASKDDTGSRAYADDGIVQEATRRITSETDAYVITDVCLCE
YTSHGHCGVVEADADTDPTLTVKNDETLSLLAETAVSHAEAGAEMIAPSAMTDGMVDAIR
TALDDAGFSDVPIMSYAAKYESAFYGPFRDAADGAPSFGDRRHYQMDPANRREASREVAL
DVEQGADVLMVKPALPYLDVVSDVRREFDRPVAAYNVSGEYAMLHAAAEKGWLDLESVAH
ESLLSIKRAGADLIITYFAEDVAETL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggagcttccacaccgaccgcggcgactccgccgcgacggcgtccgtgatctggtttcg
gagacgatgttgacccccgccgacctggttgcgcccgtgttcgtggacgcgacggcggac
gaacgcaccccgatcccgtcgatgcccggccaggagcgcgtcccgcttgccgacgccgtc
gaccggacccgggagatcctcgacaccggcgtcgaggccatcgtgctgttcggcatcccg
gcgtccaaagacgacaccgggagccgggcgtacgccgacgacggcatcgtgcaggaggcg
acgcggcgcatcaccagcgagaccgacgcctacgtcatcaccgacgtctgtctgtgtgag
tacaccagccacggccactgcggggtcgtcgaggcggacgccgacaccgaccccacgctc
acggtcaaaaacgacgagacgctgtcgctgctcgcggaaacggcggtgtcgcacgccgag
gcgggcgcggagatgattgcgccgtcggcgatgaccgacggcatggtggacgcgatccgg
actgccctcgacgacgcggggttcagcgacgtgccgatcatgagctacgccgcgaaatac
gagtcggcgttctacgggccgttccgggacgccgccgacggcgcgccgtcgttcggtgac
cgccgccactaccagatggaccccgccaaccggcgggaggccagccgcgaggtcgccctg
gacgtcgagcagggcgcggacgtgctgatggtcaagcccgcgttgccgtacctcgacgtg
gtgagcgacgtgcgccgcgagttcgaccgcccggtcgcggcgtacaacgtctccggggag
tacgcgatgttgcacgccgccgccgagaagggctggctggacctcgaatcggtcgcccac
gagagcctgctgtcgatcaagcgcgcgggcgcggacctcatcatcacgtacttcgccgag
gacgtggccgagaccctctga

DBGET integrated database retrieval system