KEGG   Halobacterium sp. NRC-1: VNG2430GHelp
Entry
VNG2430G          CDS       T00038                                 

Gene name
thrC1
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VNG2430G (thrC1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VNG2430G (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    VNG2430G (thrC1)
Enzymes [BR:hal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     VNG2430G (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1825082..1826329)
Genome map
AA seq 415 aa AA seqDB search
MTDLSLAGETPACATDGVWLACVECGGTLAPFADVVYRCPECSGLLEARYADYPGFEAFS
GRGVWRYADALPVDAGVSVQEGDTPLYEAPDVAAAAGVADVRVKHEGMNPTGSFKDRGMT
VGVRVAERLGVDRLACASTGNTSAALAAYGGRADTPVLVLLPAGKVAAGKIAQAALHGAR
ICEVDGNFDDCLDVVAELAARGEAYLLNSLNPFRLEGQKTIAFEILEQSRTATGEWPDRI
VLPVGNAGNTAALYKAFRELVAAGAMTDDEMPALTGVQAAGAAPMVEAVEAGRGRTERWT
DVETRATAIRIGNPVNAPKALPGVYETGGTAVAVSDDRITDAQRMLAGDGIGVEPASAAS
VAGLLALRERGEISADERVVCLTTGHLLKDPAAAAAAGGDTTPVPADADGVLDAL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgactgacctctcgctggcgggcgagacgccggcgtgcgcgaccgacggcgtctggctg
gcgtgcgtggagtgtggtgggacgctggcaccgttcgcggacgtggtgtaccggtgcccg
gagtgcagcggcctgctggaggcgcggtacgccgactacccgggattcgaggcgttcagt
gggcgcggggtctggcggtacgccgacgcgctcccggtcgacgcgggcgtctccgtccag
gagggcgacacgccgctgtacgaggcacccgacgtcgcggcggcggccggcgtggccgac
gtccgcgtgaaacacgaggggatgaacccgacggggagcttcaaggaccgcgggatgacc
gtgggcgtccgggtcgccgagcgcctcggcgtcgaccggctggcgtgcgcgtcgacgggg
aacacgtcggcggcgctggcggcgtacggcgggcgcgccgacacccccgtgttggtgttg
ctccccgcgggcaaggtggcggcggggaagatcgcgcaggcggcgctgcacggcgcgcgc
atctgcgaggtcgacggcaacttcgacgactgcctggacgtggtcgccgaactcgccgcc
cgcggggaggcgtacctcctgaacagcctgaacccgttccgcctggagggccagaagacc
atcgcgttcgagatccttgagcagtcccggacggccaccggcgagtggcccgaccgcatc
gtgctcccggtggggaacgccgggaacacggcggccctctacaaggcgttccgcgaactc
gtcgcggcgggcgcgatgaccgacgacgagatgccggcgctcaccggcgtgcaggccgcg
ggggcggcaccgatggtcgaagccgtcgaggcgggccgcgggcgcaccgagcgctggacg
gacgtcgagacgcgcgcgaccgccatccgcattggaaacccggtgaacgcgccgaaagcg
ctgccgggcgtctacgagacgggtggcaccgccgtcgccgtctccgacgaccgcatcacg
gacgcccagcgcatgctcgccggcgacggcatcggggtggagccggcgtcggcggccagc
gtcgcgggcctgctggcgctccgcgagcgcggcgaaatcagcgccgacgagcgcgtggtc
tgtctgaccaccggccacctgctgaaagacccggccgccgcggccgccgccgggggcgac
accacgccggtgccggcggacgccgacggcgtcctcgacgcgctctga

DBGET integrated database retrieval system