KEGG   Halobacterium sp. NRC-1: VNG2617GHelp
Entry
VNG2617G          CDS       T00038                                 

Gene name
adh2
Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    VNG2617G (adh2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VNG2617G (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    VNG2617G (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    VNG2617G (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VNG2617G (adh2)
   00626 Naphthalene degradation
    VNG2617G (adh2)
Enzymes [BR:hal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     VNG2617G (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1959213..1960256
Genome map
AA seq 347 aa AA seqDB search
MRAAVYQGPGEIAVEEVPKPDIESPEDAVIRVTHTAVCGSDLWFYRGDSDREAGSRVGHE
PMGIVEEVGDDVTSVAPGDRVIAPFAISCGECEFCRQGLYTSCVEDESWGSEANGGGQGE
YVKCPFADGTLVRVPDRYADDEDVLESLLPLTDVMGTGHHAAVSAGVGEGDTAVVVGDGA
VGLCGVLAAQRLGAERIIAMGHHEDRLELAAEFGATDTISARGDDAIERARDLTHGGANH
VMECVGAASAMDSAIAIARPGGTVGYVGVPYGVEDGGLDVFTMFSDNITIRGGVAPVRAY
AEELMADVLQGTLDPSPIFTKTVDLDGVPEGYAAMDDREAIKVLVKA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagccgtctatcagggacccggcgagatcgccgtcgaagaggtaccgaaaccc
gacatcgagtcgcccgaggacgccgtgattcgcgtgacccacacggcggtctgtggctcc
gacctctggttctatcggggggacagcgaccgcgaggcggggtcgcgggtcggccacgag
cccatgggcatcgtcgaggaagtcggcgacgacgtgacctcggtcgcgcccggggaccgc
gtcatcgcaccgttcgccatctcctgtggggagtgtgagttctgccggcagggcctgtac
acctcctgcgttgaagacgagtcctggggcagcgaggccaacggcgggggccagggcgag
tacgtcaagtgtccgttcgcggacggcacgctcgttcgggtgccggaccgctacgccgac
gacgaggacgtactcgaatcgctgctgccactgaccgacgtgatgggcaccggccaccac
gccgccgtcagcgcgggcgtcggcgagggtgacacggccgtcgtcgtcggcgacggcgcg
gtcgggctgtgcggcgtgctcgccgcccagcgcctcggtgccgagcgcatcatcgcgatg
ggccaccacgaggaccgcctcgaactcgccgcggagttcggcgcgacggacacgatctcg
gcgcgcggcgacgacgcaatcgagcgagcgcgagacctcacgcacggcggcgcgaaccac
gtcatggagtgcgtgggcgcggcgtccgcgatggactccgccatcgccatcgcgcggccc
ggcggcaccgtcggttacgtcggcgtgccctacggcgtcgaggacggcgggctggacgtg
ttcaccatgttctcggacaacatcaccatccggggcggggtcgcgccggttcgggcgtac
gccgaggagctgatggccgacgtgctgcaggggacgcttgatccgtcgccgatcttcacg
aagaccgtcgacctcgacggtgtcccggaggggtacgcggccatggacgaccgggaggcg
atcaaagtgctggtgaaggcctga

DBGET integrated database retrieval system