KEGG   Halobacterium sp. NRC-1: VNG2617GHelp
Entry
VNG2617G          CDS       T00038                                 

Gene name
adh2
Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:hal01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hal00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:hal00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:hal00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:hal00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:hal00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1959213..1960256
Genome map
AA seq 347 aa AA seqDB search
MRAAVYQGPGEIAVEEVPKPDIESPEDAVIRVTHTAVCGSDLWFYRGDSDREAGSRVGHE
PMGIVEEVGDDVTSVAPGDRVIAPFAISCGECEFCRQGLYTSCVEDESWGSEANGGGQGE
YVKCPFADGTLVRVPDRYADDEDVLESLLPLTDVMGTGHHAAVSAGVGEGDTAVVVGDGA
VGLCGVLAAQRLGAERIIAMGHHEDRLELAAEFGATDTISARGDDAIERARDLTHGGANH
VMECVGAASAMDSAIAIARPGGTVGYVGVPYGVEDGGLDVFTMFSDNITIRGGVAPVRAY
AEELMADVLQGTLDPSPIFTKTVDLDGVPEGYAAMDDREAIKVLVKA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagccgtctatcagggacccggcgagatcgccgtcgaagaggtaccgaaaccc
gacatcgagtcgcccgaggacgccgtgattcgcgtgacccacacggcggtctgtggctcc
gacctctggttctatcggggggacagcgaccgcgaggcggggtcgcgggtcggccacgag
cccatgggcatcgtcgaggaagtcggcgacgacgtgacctcggtcgcgcccggggaccgc
gtcatcgcaccgttcgccatctcctgtggggagtgtgagttctgccggcagggcctgtac
acctcctgcgttgaagacgagtcctggggcagcgaggccaacggcgggggccagggcgag
tacgtcaagtgtccgttcgcggacggcacgctcgttcgggtgccggaccgctacgccgac
gacgaggacgtactcgaatcgctgctgccactgaccgacgtgatgggcaccggccaccac
gccgccgtcagcgcgggcgtcggcgagggtgacacggccgtcgtcgtcggcgacggcgcg
gtcgggctgtgcggcgtgctcgccgcccagcgcctcggtgccgagcgcatcatcgcgatg
ggccaccacgaggaccgcctcgaactcgccgcggagttcggcgcgacggacacgatctcg
gcgcgcggcgacgacgcaatcgagcgagcgcgagacctcacgcacggcggcgcgaaccac
gtcatggagtgcgtgggcgcggcgtccgcgatggactccgccatcgccatcgcgcggccc
ggcggcaccgtcggttacgtcggcgtgccctacggcgtcgaggacggcgggctggacgtg
ttcaccatgttctcggacaacatcaccatccggggcggggtcgcgccggttcgggcgtac
gccgaggagctgatggccgacgtgctgcaggggacgcttgatccgtcgccgatcttcacg
aagaccgtcgacctcgacggtgtcccggaggggtacgcggccatggacgaccgggaggcg
atcaaagtgctggtgaaggcctga

DBGET integrated database retrieval system