KEGG   Halobacterium sp. NRC-1: VNG2629GHelp
Entry
VNG2629G          CDS       T00038                                 

Gene name
glcK
Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hal  Halobacterium sp. NRC-1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VNG2629G (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VNG2629G (glcK)
   00052 Galactose metabolism
    VNG2629G (glcK)
   00500 Starch and sucrose metabolism
    VNG2629G (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    VNG2629G (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    VNG2629G (glcK)
   00524 Butirosin and neomycin biosynthesis
    VNG2629G (glcK)
Enzymes [BR:hal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     VNG2629G (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1967776..1968756)
Genome map
AA seq 326 aa AA seqDB search
MHYAGVDLGATNVRGAVSDESGRIVGVDRRKTPSGPTGIAVTETVLAVMRAAAADAGVAP
TAIEAAGIGSIGPLDLANGAIDSPANMPASVETIPLVGPLANLLGVDTERVFLHNDTVAG
VIGERFYADRTPDDMAYLTISSGIGAGIAVDGTVIGGWDGNAGELGHMVVDPRGRRTCGC
GRDGHWEAYCSGNNIPEYARLLADDADGVETALPLDSGGFTAKDVFECAADGDTFAAHVV
EQLGVWNGIGVTNLVQAYAPLVVYVGGAVALHNPEQVLGPIRAYIQERVFSNVPEIRLTT
LGDDVVLKGAIASALTGGTGDSTHAP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcactacgcgggcgtcgacctcggggcgacgaacgtgcgtggggcggtcagtgacgaa
tccggacgcatcgtcggcgtcgaccggcggaagacgcccagcggcccgaccgggatcgcg
gtcacggagaccgtgctggcagtgatgcgcgcggcggccgcggacgccggcgtcgcgccg
acggcgatcgaggccgcgggcatcggcagcatcggccccctggatctcgcgaacggtgcc
atcgactccccggcgaacatgccggcgtcggtggagacgatcccgctggtcggcccgctg
gcgaacctgctgggggtcgacacggaacgcgtgttcctgcacaacgacacggtcgccggc
gtcatcggggagcggttctacgccgaccgcacgccggacgacatggcgtatctcacgatc
tcctcggggatcggcgcggggatcgccgtcgacggaaccgtgatcggggggtgggacggc
aacgccggcgagctcgggcatatggtggtggacccgcgcggccggcggacgtgtgggtgt
ggccgggacggccactgggaggcgtactgctcggggaacaacatccccgagtacgcgcgc
ctgctggccgacgacgccgacggcgtggagacggcactgcccctggacagcggggggttc
acggccaaagacgtcttcgagtgtgcggccgacggcgacacgtttgccgcccacgtcgtc
gagcaactcggggtgtggaacgggatcggcgtgacgaacctcgtccaggcgtacgctccg
ctggtggtgtacgtcggcggggcggtcgcgctgcacaaccccgagcaggtgcttgggccg
atccgagcttacatccaggagcgcgtgttcagcaacgtcccggagatccggctgacgacg
ctgggcgacgacgtggtgctgaagggcgcgatcgcgtcggcgctcacgggcgggaccggt
gacagcactcacgcgccgtga

DBGET integrated database retrieval system