KEGG   Helianthus annuus (common sunflower): 110901162Help
Entry
110901162         CDS       T05101                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
han  Helianthus annuus (common sunflower)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:han00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    110901162
   00500 Starch and sucrose metabolism
    110901162
Enzymes [BR:han01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     110901162
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
AA seq 530 aa AA seqDB search
MPFAVLVDELHWIWPKSRILEGPMYYKGVYHFFYQHNPYGPLWGNMSWGHAISHDLINWV
HLDIALVPNEHYDINGCFSGSATILPNGEPAILYTGVDAKLHQVQNLAFPKNISDPLLKE
WVKWPLNPILSPPDEIDPSFYRDPSTGWMGADGEWRVVIGTRIDHQGAAILYKSKDFRSW
NRSLSPFPLSNITTFWECPEFYPVISSGKSGLDTSVISVQGKDIKHVLKASFNDQDYYIL
GKYDPESDRYDVDADFMKSKEWLRYDYGKFYTSKSFYDGEKKRRILWSWVSESDTAPDAI
EKGWSGLQTIPRSIWLSKNEDQLVQWPVQELEKLRTRKVHFKNKRLKGRSMIEISGITAS
QADVEITFRVSNLKHAEVLSAEVVDPQILCTQKNTTTDGKFGPFGLLVLASKNLTEHTAV
FFRVFRIANSFRVLMCADPSRSSLKPFIDKPIYGAFLALDPRYAKISLRTLIDHSIVESF
GGEGLACITSRVYPVLAVGEQAHLYAFNNGTKSLSISSLSAWSMKKAQIV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttgcagttttggttgatgagctgcactggatctggccaaagagtcgaatcctg
gaaggaccaatgtattacaagggggtctaccattttttctatcaacacaatccatatggt
ccactatggggtaacatgtcatggggtcatgccatatcacatgatcttatcaactgggtt
catcttgatattgctcttgtaccaaacgagcattacgatatcaatgggtgcttttctggt
tcggcaacgatactaccaaatggtgaaccggcgatcctatacacaggtgttgatgccaaa
ttacaccaagtgcaaaatttggcatttcccaaaaacatatcggacccgctactaaaagaa
tgggtaaaatggccacttaacccaatattgagtcctccagatgaaattgacccatccttt
tatagagatccatcaactggttggatgggtgcggatggagaatggagggttgtgattgga
actcggattgatcatcaaggagcagctattctttacaaaagtaaggattttcgcagttgg
aataggtctctgagcccgtttcccctttctaacataacaacattttgggaatgtcctgag
ttttatcctgttatttctagtgggaaaagcgggcttgatacatcagttatatccgttcaa
gggaaggacattaagcatgttcttaaagctagttttaatgaccaggattattatatactg
ggaaaatatgatccagaaagtgaccgctacgatgttgatgctgacttcatgaagagtaaa
gagtggttacggtatgattatgggaagttttatacttcaaagtcgttttatgatggtgag
aagaagagaaggatattatggtcatgggttagtgaaagtgatactgcaccagatgctatc
gaaaaaggttggtctggccttcagacgattcctaggagcatctggcttagtaaaaatgaa
gatcagttggtgcagtggcctgtccaggaactagagaaactacgaacacgaaaagtgcat
ttcaagaataaaagactcaagggcaggtccatgattgaaatttctggtatcacagcttca
caggctgatgtagaaatcacatttagagtctcaaatctcaaacatgctgaggtgttgagt
gctgaagtagttgatccccaaattctttgtacacaaaaaaatactacaacagatggcaaa
tttgggcctttcggtttgctggttttggcttcgaagaaccttactgaacacactgcggtc
ttctttcgtgtctttagaattgctaacagtttccgagtgctcatgtgtgctgacccaagc
aggtcgtctttaaaaccatttatcgacaaacccatctatggagcttttcttgcacttgat
cctcgatacgcaaagatctccttgagaaccttgatagatcactccattgtagaaagcttt
ggtggagaagggttggcttgcattacatcaagagtttatccagtactggcagttggagaa
caagcacatctttatgcattcaacaatggcactaagagtttgagtatctcaagtttaagt
gcttggagtatgaagaaagctcaaattgtctaa

DBGET integrated database retrieval system