KEGG   Helianthus annuus (common sunflower): 110930102Help
Entry
110930102         CDS       T05101                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV3-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
han  Helianthus annuus (common sunflower)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:han00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    110930102
   00500 Starch and sucrose metabolism
    110930102
Enzymes [BR:han01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     110930102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
AA seq 517 aa AA seqDB search
MLYQGVYHFFYQYNPLAPTFGTIVWGHAVSHDLVNWIHLDPAIYPTDEPDISSCWSGSAT
ILPGNLPAMLYTGSDSTSRQVQDLAWPKNRSDPFLREWVKSTHNPIITPPEGVKDDCFRD
PSTAWLGPDGLWRIVVGGDRDNNGMAFLYQSPDFVTWTRYENPLAAADSTGTWECPDFFP
VPLNSTNGLDTSVVSSGSVLHVMKAGFEGHDWYTIGTYSPDRENFLPQNGLSLSGSTLDL
RYDYGNFYASKSFFDESKNRRVLWAWVPEKDSEEDDIEKGWAGLQSFPRALWIDRSGKQL
IQWPVEEIETLRENEVKLKNKRLKSGSVVEIEGVTASQADVTISFKLEDLKEAEVVDTCS
ADPQALCTDKGASSKGVIGPFGVLAMASKDLKEQTAIFFRVFQNQKGRYSVLMCSDLSRS
TIRSTIDKTSFGAFVDIDPRYDEISLRNLIDHSIIESFGAGGKTCITSRVYPQFLNYEDA
HLFAFNNGTQSVKISQMSAWSMKNAEFTIDQTVKSAT
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttataccaaggcgtctaccacttcttctaccaatacaacccactggcccccactttc
ggcaccatcgtgtggggccacgccgtatcccacgacctcgtcaactggatccacctagac
ccggcaatctacccgaccgacgaacccgacatcagcagctgctggtccggatccgccacc
atcctcccgggtaaccttccagccatgctctacaccggtagcgactccacttcccgccaa
gtccaagacctcgcctggcctaaaaatcgctccgacccgtttctccgcgaatgggtcaaa
tccacccacaacccgataataaccccacccgaaggcgtcaaagacgattgttttcgagac
ccgagcaccgcgtggctcgggcccgatggcttatggcgaattgttgtcggtggtgatcgt
gacaacaacggtatggcgtttttgtaccagagtccggattttgtaacctggactcggtat
gagaatccgcttgcggcagcggattctacgggtacatgggagtgtcccgacttttttcct
gtcccgttgaatagtaccaacgggctggatacgtctgttgtgagtagtgggagtgttttg
catgtgatgaaagcgggatttgaagggcatgattggtacacgatcgggacgtatagtcct
gaccgcgagaactttttgccgcaaaacgggttgagtttgagtgggagcacgttggatttg
agatacgactatggaaacttttatgcgtcaaagtcattctttgacgagtcgaagaacagg
agggttttgtgggcgtgggttcctgaaaaagattcggaagaagatgatattgaaaaagga
tgggctgggcttcagtcgtttccaagggccctttggattgacagaagtgggaagcagttg
atccagtggccggtggaggagatagaaacacttcgtgaaaatgaagttaagcttaaaaac
aagaggctcaaatccgggtctgttgtcgaaatcgagggtgttactgcttctcaggcggat
gttacaatttcgtttaaattggaggatttgaaagaggcggaggttgtggatacgtgttcg
gctgatccgcaagcactttgtaccgacaagggtgcatcaagcaagggtgtaatcgggcct
tttggtgttttggctatggcatctaaagacttgaaagaacaaaccgcgattttctttagg
gttttccaaaaccaaaaaggacgctattctgtgctcatgtgtagcgaccttagcaggtct
acaatcagaagcaccatcgacaagacaagttttggcgcgtttgttgacatagatcctcga
tacgatgagatctcactaagaaacttgatcgaccactcaatcatcgagagtttcggagca
ggcggaaaaacatgcatcacaagtcgggtctatccacaatttcttaactatgaggatgct
catctttttgcatttaacaacggcactcaaagcgtcaagatttctcaaatgagtgcttgg
agtatgaaaaatgcggaatttaccatcgaccaaaccgtaaaaagtgcaacttaa

DBGET integrated database retrieval system