KEGG   Halothece sp. PCC 7418: PCC7418_0054Help
Entry
PCC7418_0054      CDS       T02379                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hao  Halothece sp. PCC 7418
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hao00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PCC7418_0054
DNA repair and recombination proteins [BR:hao03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PCC7418_0054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(62685..63296)
Genome map
AA seq 203 aa AA seqDB search
MGEKTTNYTPPLARLIERLQGLPGVGPKTAQRLAFHILKRPEAEVEALAKALIEAKKQIG
LCRVCFHLSADSVCEICSNSNRDDSTICVVSDSRDVIALEKTREYSGKYHVLGGVISPMD
GIGPEQLHIQPLVERVSQEKVKEVILAISPSVEGDTTTLYLGQLLKPFTRVTRIAFGLPM
GGDLEYADEITLARALEGRRDLE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
attggagagaaaactacgaactacaccccacccctggctcgtctcattgaacgattacaa
ggcttacctggtgttggtccgaaaaccgcccaacgtcttgcttttcatatcttaaaacgc
cccgaagcagaagtcgaagccctggcaaaagccctgattgaagcgaaaaaacaaatcggg
ttatgtcgggtttgctttcatctcagtgctgattcagtttgtgaaatttgcagcaactct
aaccgtgatgacagtaccatttgtgtcgtctctgattctcgggatgtgattgctttagaa
aaaacccgagaatattctgggaaatatcatgtcctcgggggggtgatttctccgatggat
gggattggtcccgaacaactgcacattcaaccgttagtggaacgagtgagtcaagagaag
gtaaaagaggtcattcttgccattagccctagtgtggaaggagatacaaccactctatat
ttgggtcaattgttaaaaccttttactcgtgtcactcgcattgcctttggtttgccaatg
gggggggatttagaatatgctgatgaaattacgcttgcacgggcgttagaaggacgaaga
gatttagagtga

DBGET integrated database retrieval system