KEGG   Halothece sp. PCC 7418: PCC7418_0324Help
Entry
PCC7418_0324      CDS       T02379                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hao  Halothece sp. PCC 7418
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hao00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PCC7418_0324
Enzymes [BR:hao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PCC7418_0324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
368480..369277
Genome map
AA seq 265 aa AA seqDB search
MTLNNKTILVTRAARQAPTFRTLLEQQGATVIEMAALEICPPSSWEALDQAIHNLSRFDW
LILTSANGVNFFWERLKELNMNPDLLKSLKIAVVGQKTARVLEKKGLEPTFIPPHFVADS
LVETFPEALSGQKLLFPRVETGGREVLIEEFQQQNAEVIAVPAYQSRCPEKADRVAVQAL
RTGQVDVITFASSKTVQHFYELLIPTFGSGVNLKSILEEVIIASIGPQTSQACYKFLGRC
DIEAKHYTLEGLTQAIVEFCSDNRI
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgactctgaacaacaaaacaattttagtcacacgggctgctcgccaagccccaactttt
cgcacacttctagaacaacagggggcgacggtgattgaaatggcagctttagaaatttgt
cctccttccagttgggaagcgcttgaccaagcaattcataatctatcaaggtttgattgg
ttgattttaacttccgccaatggggttaattttttttgggaacgtctaaaagagttaaat
atgaatcctgatctcctgaaatctctcaagattgcagtagtgggtcaaaaaactgcgcgt
gttttggagaaaaaaggactggaaccgacatttattcccccgcactttgtagctgattct
ttagtggaaacctttccagaggctttatcaggacagaaactcctattcccgcgcgtagaa
actggagggcgagaggtgttgattgaggaatttcaacaacagaatgcggaagtgattgca
gttcccgcttatcaatcccgttgtcccgaaaaagccgatcgcgttgcggtgcaagcctta
cgaactggacaagtggatgtgattacttttgctagttctaaaacggttcaacatttttat
gagctcttgattccgacttttggctctggggtaaacttgaaaagtatcttagaagaagtg
attattgcttcaattggtcctcaaacttcccaagcctgttacaagttcttaggaagatgc
gatattgaggcgaaacactatactctagaagggttaacacaagcgattgtggaattttgc
tctgataataggatataa

DBGET integrated database retrieval system