KEGG   Halothece sp. PCC 7418: PCC7418_0327Help
Entry
PCC7418_0327      CDS       T02379                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
hao  Halothece sp. PCC 7418
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hao00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PCC7418_0327
Enzymes [BR:hao01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PCC7418_0327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(372336..374411)
Genome map
AA seq 691 aa AA seqDB search
MVTSTTSLSNPTFPLTAVVGQEAIKLALLLSAVDPKLGGIAISGKRGTAKSVMARAIHSL
LPPFEIVQGSMSNCDPQNPEEWDDETFAQYGDTTDIPTEVIRAPFVQIPLGVTEDRLLGS
VDVEKSVKEGKTVFQPGLLAQAHRGVLYIDEINLLDDQIANQLLSVISEGRNVIEREGIS
FQHPCKPLLIATYNPEEKPLREHLLDRIAITLSADGVLALDQRVQAVEQAIGFANSQQSF
LDQYEEDLEGLRTDIILAREWLKEVTIAPEQINYLVEEAVRGVVQGHRAELFAVRVAKAA
AALDGRNQVTGDDLRRAVELVIVPRSTVAQSPPEQQEQEPPPPPPQNQEEDQDQGEGETP
PEDQQEPEQPPENEQEESPQDEDGEDDEEQEAPQIPEEFVFDAEGVIMDPTVLYFSQMAQ
QQGTSGSRGLIFSDERGRYVKPMLPKGKVKRIAVDATLRAAAPYQKARRLRQPHRKVIVE
QTDMRSKRLARQAGALVVFLVDASGSMALNRMQSAKGAVLQLLTEAYENRDQVALIPFRG
EQAEVLLPPTRSISMARNRLEKLPCGGGSPLAHGLTQAVHVGTNAQMSGDVGQVILVAIT
DGRGNIPLARSLGEPLSEDEKPNIKEELLDIAGKIRAIGVKLLVIDTENKFVSTGFAKEL
AKAAGGNYYHLPKATDSAIAGMAKQAIADMK
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggttacttcaacaacgtctctctccaatcctacttttcccctgaccgccgtggtcgga
caagaagccattaagctggcgttactcctcagtgctgttgatcccaaactggggggaatt
gccatttccggtaagcgtggaaccgccaaatccgtgatggcgcgagcgattcattccttg
ttacctccctttgaaattgttcaagggtcgatgtccaattgtgatccgcaaaacccagag
gaatgggatgatgaaacgtttgcccaatatggcgataccacagacatccccactgaggtg
attcgtgcgccttttgtgcagattcccttaggcgtaacggaagaccgtttactggggtcg
gtggatgtagaaaagtccgtgaaagaaggaaaaaccgttttccaacctggactactggcg
caagcccatcggggagttctctacattgatgaaattaacctcctggatgaccaaattgcc
aaccagttactttcggtaatcagtgaagggcgcaatgtgattgaacgggaaggaattagt
tttcaacatccctgcaaaccgttattaattgccacttataacccagaagaaaagccgtta
cgagaacatttattagatcgcattgccattaccctctccgccgatggcgttttagccctc
gatcagcgtgtgcaagcggtggaacaagcgattgggtttgccaactcccaacaatccttt
ctcgaccaatatgaggaagatttagaaggactgcggacggatatcatcttagcgcgagaa
tggttgaaagaagtgacgatcgcgccagaacagattaattatttagtagaagaagccgtg
cgtggggttgtgcaaggacatcgggcggaattatttgccgtgcgcgtggcaaaagcagca
gcagccctggatgggcgcaaccaagtcacaggagatgacttacgccgtgcggtagaatta
gtgattgtcccccgttccactgtggcgcaaagtcccccggaacaacaagaacaagaaccg
ccaccgccccctccacaaaatcaagaagaggatcaagatcaaggggaaggagaaacgcca
ccagaagatcaacaagaaccagaacaaccccctgaaaatgaacaggaggaatccccacaa
gatgaagatggggaggatgacgaggaacaagaagccccgcaaatcccggaagagtttgtc
tttgatgcggaaggggtaattatggatcccaccgtgctttatttcagtcaaatggcacaa
cagcagggaacttctgggagtcgggggttaatcttctccgatgaacggggacgttatgtg
aagccaatgcttccgaaagggaaagtgaagcggattgcagtggatgcgactcttcgcgct
gctgcaccttatcagaaggcacgacggctgcgtcaaccccatcggaaagtcatcgtggaa
caaactgatatgcgctcaaaacgcctagctagacaagcgggggcgttagtggtgttttta
gtggatgcgtcgggttcaatggcgttaaatcggatgcaatcggcaaaaggggcggtttta
caactgttgacggaagcctacgaaaatcgcgatcaggtggcgttgattccgtttcgtggg
gaacaagcagaagttttattaccgccaacgcgatccatttccatggcgcggaatcgctta
gaaaaactcccttgtgggggcggttcaccgttggcgcatggtttaacgcaagcggttcat
gtgggaacgaatgctcaaatgtcgggcgatgtgggacaagtgattttagtcgcgattacc
gatggacgaggaaatattcccttagcgcgatcgctgggtgaaccgttatctgaagacgaa
aaacccaatattaaagaagaattgctggatattgcgggtaaaatccgcgcgatcggtgtg
aagttactggtgattgacacagaaaacaagtttgtttccacaggttttgcaaaagaattg
gctaaagcagcaggcgggaactattatcatcttccgaaagcaaccgacagcgcgatcgcg
ggaatggcaaaacaagccattgcagatatgaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system