KEGG   Halothece sp. PCC 7418: PCC7418_0402Help
Entry
PCC7418_0402      CDS       T02379                                 

Definition
uroporphyrinogen-III C-methyltransferase (EC:2.1.1.107)
Orthology
K02303  
uroporphyrin-III C-methyltransferase [EC:2.1.1.107]
Organism
hao  Halothece sp. PCC 7418
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hao00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PCC7418_0402
Enzymes [BR:hao01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     PCC7418_0402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(449270..449977)
Genome map
AA seq 235 aa AA seqDB search
MKIYLIGAGLGNAQYLTQQAQQYLKKADVLIYDALVDEEIINLVPSYCQKVDVGKRGGQA
STPQSEINRLLIEFAQTNQYVIRLKNGDPFIFGRAREEIEALKTIGCEVEIISGLSSAIT
APLLAGIPLTDKVLSRSFSVVTAHEPETLDWNVLARMDTLVILMGGRNLAMITEQLIAEG
KASSCPIAIIRKAGTDEQTVWVGTLETIVEITQGNQLSPTVMVVGDVVNLRSLLS
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatttatctaattggagcgggtttaggaaatgcccaatatttaacccaacaagcc
caacaatacttaaaaaaagcggacgttttaatttatgatgccctagttgatgaagaaatt
atcaatcttgttccttcctattgtcagaaagttgatgtgggaaaacgagggggacaagcg
agtacgcctcaaagtgaaatcaatcgtttattaattgaatttgcccaaaccaatcaatat
gttattcgcctcaaaaatggtgatccgtttatttttggtcgcgctagggaggaaattgaa
gcattaaaaacgattggttgcgaagtagaaattatttcaggtttatcttcagcaattact
gccccacttctggctggaattcccctcacggataaagttttaagtcgtagttttagtgtg
gtaacggctcatgaaccagagactttagactggaatgttttagcaagaatggataccctt
gttattttaatggggggtcgaaatttagctatgattactgaacaattaattgcagaagga
aaagcatcttcttgtcccatagcaatcatccgcaaagcgggaacagatgagcaaacggtt
tgggtgggaactttagaaacaattgtcgaaatcacccaaggtaatcaactctctcccaca
gttatggtcgtgggagatgtagttaatttaagatcgcttttatcataa

DBGET integrated database retrieval system