KEGG   Halothece sp. PCC 7418: PCC7418_0405Help
Entry
PCC7418_0405      CDS       T02379                                 

Definition
DNA-(apurinic or apyrimidinic site) lyase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
hao  Halothece sp. PCC 7418
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:hao03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(451691..452527)
Genome map
AA seq 278 aa AA seqDB search
MPELPEVETVCRGLNQSTSGQVFQGGEVLLERSIAHPASITEFWSGLQDTAIKQWQRRGK
YLLAELSSGGWLGLHLRMSGQLLWVKQSDPVAKHTRVRFFFPEEQELRFIDLRTFGRVWW
VPPQTDPKTIITGLNQLGVEPFSAEFTPAYLQEKLKTRRCAIKTALLDQKIIAGIGNIYA
DEALFLGKIFPLRPANTLQGSEVEQLQQAILSVLKTGIEEGGTTFNSFKNLLGVNGNYMG
RAWVYGREGESCRQCGTTIERYKINGRSSHFCPCCQPE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgccagagttaccagaagttgaaaccgtctgtcgtggattgaatcaatccacaagcgga
caagtttttcagggtggggaagtgttactggaacgtagcattgctcaccctgcttctatt
accgagttttggtcgggattacaggataccgcgatcaaacaatggcaacgacgaggaaaa
tatttgttagctgaactctcttctgggggatggttagggctgcatttgcggatgagcggt
caattattatgggtcaagcaaagtgaccccgtagcgaaacatacccgagtgcgtttcttt
tttccagaggaacaagaactgcgttttatcgatttacgaacctttggtcgggtgtggtgg
gttccccctcaaactgacccaaaaaccattatcacgggcttaaatcagttgggagttgag
cctttttctgctgagtttacccccgcttatttacaggaaaaattaaaaactcgtcgttgt
gccattaagacagctttgttagatcaaaaaattattgctggcattggtaatatttacgcg
gatgaagccctttttctgggaaagattttcccgttacgcccagcgaatacgttgcaaggg
tcagaagtggaacagctacagcaagcgattctttctgtgcttaaaacaggtattgaagag
gggggaacaacatttaacagctttaagaaccttttaggggttaatggcaattatatgggc
agagcttgggtttatggtcgcgagggagaaagttgtcgtcagtgtggaacaaccattgag
cgatacaaaattaatggacgttcttctcatttttgcccttgctgccaaccggaatga

DBGET integrated database retrieval system