KEGG   Halothece sp. PCC 7418: PCC7418_0457Help
Entry
PCC7418_0457      CDS       T02379                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
hao  Halothece sp. PCC 7418
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hao00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
510618..512120
Genome map
AA seq 500 aa AA seqDB search
MQLDRASGILLHPTSFPSRYGIGDLGGEAYEFVDFLAGSGQTVWQVLPLGPTGFGNSPYL
SYSALAGNPLLISPDKLVEEGLLTHEEVDQFPNLPEERVDFDRVEAIKMPLLRQAFERFA
KLPEDQRGPYHDFCNQHSYWVEDFAFFMALKEAHNGISWHEWEEGLAKRDPNTLQKWKEH
LGWEIYYHKYLQFEFYRQWQNLKNYANERQIKILGDIPIYVAHDSMAVWVHQDIFCLDPE
TCQPSLMAGVPPDYFSEGGQLWGNPVYNWEQVEANGFDWWLNRFEGTLDYVDLLRIDHFR
GFESFWAVPQGEKDARNGHWVQAPGEKFFKILRERLGELPIVAEDLGIITSNVEALRAQF
NFPGMKVLHFAFDSGPENPYLPFNYHDRNCLVYTGTHDNDTTVGWYKKRNAEQKETVRQF
VGGISSEGVHWSLIRVALGSVANQAMIPLQDILGLGSEARMNTPSQLGENWAWRYRRDEL
TNELRDRLGMLTELYGRAPS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttgaccgagcaagcggaattttacttcatcccacctcctttcccagtcgctac
ggaattggagatttggggggagaagcctatgaatttgttgattttttagcaggaagcgga
cagactgtatggcaagtgcttcccttgggaccgacggggtttggaaattctccttattta
tcttattcagcattagcgggaaatcctttattaatcagtcccgataaactcgttgaggaa
gggttattaacccatgaagaagtggatcaatttcccaacttacccgaagaaagagtagat
tttgatcgcgtggaagccatcaaaatgccccttctgcgtcaagcctttgaacggtttgcc
aaactccccgaagatcaacgcggtccctaccatgatttctgtaatcaacatagctattgg
gtggaagattttgccttctttatggcgttaaaagaagcccataatgggattagctggcat
gaatgggaagaaggactcgccaagcgcgatcccaacaccctacaaaaatggaaagaacat
ctgggatgggagatttattaccataaatatctccaatttgagttttatcgccaatggcaa
aacttaaaaaactatgccaacgagcgacaaattaagatcctaggcgatattcccatttac
gtcgctcatgacagcatggcggtttgggtgcaccaagatatcttttgtctggatccagaa
acttgccaaccctctttaatggcgggtgttccccccgattacttcagtgaaggcggacag
ttatgggggaatcccgtttataactgggaacaagtggaagccaatgggtttgattggtgg
ttaaatcgctttgaagggacgctggattatgtagatttactccgaatcgaccatttccga
ggctttgagtccttctgggcggttccccaaggagaaaaagatgcgcggaatggtcattgg
gtacaagcccctggtgagaagttctttaagattttgcgggaacgtctcggtgaattgccc
attgtcgctgaagatttagggattattacttccaatgtggaggctctacgagcacagttt
aatttcccaggaatgaaagtcttacactttgcctttgattcgggtccggaaaatccttat
ttaccctttaattatcatgaccgtaactgtttggtttatacgggaacccatgataatgat
acaacggttggctggtacaagaagcgtaatgcggaacaaaaagaaacggtgcgtcagttt
gttggcggtatttcttcggaaggggtgcactggagtttgattcgggtggctctaggatca
gtggcaaatcaggcgatgattcccctccaagatattttaggcttggggagtgaggcgcgg
atgaatacgcccagtcagttaggagaaaattgggcgtggcgttatcgtcgtgatgagttg
acgaatgagttgcgcgatcgattgggaatgttaaccgaactctatggtcgcgctcccagt
tag

DBGET integrated database retrieval system