KEGG   Halothece sp. PCC 7418: PCC7418_0481Help
Entry
PCC7418_0481      CDS       T02379                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hao  Halothece sp. PCC 7418
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hao00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PCC7418_0481
Enzymes [BR:hao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PCC7418_0481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
541526..542023
Genome map
AA seq 165 aa AA seqDB search
MSTREEIPSAIALGSNLGDSQNILEQAIHQLGTDPAVKVNAVSSWYETLPIGPAQPNYLN
GCALLTSSLSPGELLATLLQIETAFGRVRQERWGARTLDLDLLLYDDQVIETEDLQLPHP
RMRERAFVLVPLAEIAPNWIDPVTGCAIAQLKENIDCSGVLQKLQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaagggaagaaatccctagcgcgatcgcgctagggagtaatttaggtgattct
caaaacatcctggaacaagcgattcaccaattaggaactgatcctgcagtgaaggtaaac
gcggtttccagttggtatgaaaccctccccattggacctgctcaacccaattatctcaat
ggctgtgctttattgactagttccttatcccctggggagctcttagccactttactccaa
attgaaaccgcatttgggcgcgtgcgccaagaacgttggggagcgcgtacccttgattta
gatctccttttatatgatgatcaggtaatagaaaccgaggacttacaactgcctcatccg
cgcatgagagaacgggcgtttgttttagttccccttgctgaaattgccccgaattggatt
gatccagtaacaggatgcgcgatcgcgcaactgaaagaaaacatcgactgttctggtgtc
ttacaaaaacttcaataa

DBGET integrated database retrieval system